KEGG   Pseudomonas fulva: Psefu_1165Help
Entry
Psefu_1165        CDS       T01501                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pfv  Pseudomonas fulva
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psefu_1165
  Energy metabolism
   00680 Methane metabolism
    Psefu_1165
Enzymes [BR:pfv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Psefu_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1274340..1276976
Genome map
AA seq 878 aa AA seqDB search
MTQIDARLREDVHQLGELLGTTIRDQHGEAFLDKIERIRKGAKAARQGSADGARQLSETL
DGLHDDELLPVARAFNQFLNLANIAEQYHRVRRRATGEAQPFENRVFDELLQRLRANGHE
PAALARQVAELDIELVLTAHPTEVSRRTLIQKYDAISAQLAEQDHSDLSGAEREAIASRL
QRLIAEAWHTEEIRRVRPTPVDEAKWGFAVIENSLWYALPTVMRKADQALQRETGQRLPL
DAAPIRFASWMGGDRDGNPNVTAKITREVLLLARWMAADLYLRDIDSLAAELSMQRANDE
LRARAGDSAEPYRAVLKQLRERLRATRTWAHESLAGPVNPPAQVLHDNAELREPLLLCYR
SLHDCGMGVIADGPLLDFLRRVSTFGLFLVRLDVRQDATRHASAMAEITEYLGLGRYDSW
GEEQRLAFLQDELSGRRPLLPADFNPSDDTAEVLATCREVAAAPAASLGSYVISMAGAAS
DVLAVQLLLKEAGLRRPMRVVPLFETLADLDNAAVAIERLLGLPDYRAGLQGPQEVMIGY
SDSAKDAGTTAAAWAQYRAQESLVRICREHDVELLLFHGRGGTVGRGGGPAHEAILSQPP
GSVNGRFRTTEQGEMIRFKFGMPDIAEQNLNLYLAAVLEATLLPPPVPQEAWRAQMDKLA
ADGVATYRGVVREHPQFVEYFRQATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWEAALRNALERGEGEVLREMREQWPFFRTRIDMLEMVLAKADESIARLY
DERLVTAELQPLGAHLRDLLSQASEVVLGLTGQSQLLVHSPETLEFITVRNTYLDPLHLL
QAELLARSRQREQEPGSALEQALLVSVAGIAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaatcgatgcacgtctacgcgaggatgttcaccagctcggtgagctgctcggc
accaccatccgcgaccagcacggcgaggcgtttctcgacaagatcgagcgcatccgcaag
ggcgccaaggcggcgcgccagggctcggccgacggcgcccggcagctcagcgaaaccctc
gacgggctgcacgacgacgagctgttgccggtggcccgcgccttcaaccagtttctcaac
ctggccaatatcgccgagcagtatcaccgcgtgcgccgtcgtgccaccggcgaggcgcaa
cccttcgaaaaccgcgtgttcgacgagctgctgcagcgcctgcgtgccaatggccatgag
cccgcagccctggctcgccaggtcgccgagctggatatcgaactggtgctcaccgcgcac
cccactgaggtatcacggcgcacgttgatccagaagtacgacgcgatttccgctcagctg
gccgaacaggatcacagcgacctgtcgggcgccgaacgcgaggccatcgccagccgactg
caacggttgatcgccgaggcctggcacaccgaggaaattcgccgcgtacggccgaccccg
gtggacgaagccaagtggggcttcgcggtgatcgagaactccctgtggtacgcattgccg
acggtgatgcgcaaggccgaccaggcgttgcagcgtgagaccgggcaacgcctgccgctg
gacgctgcaccgattcgcttcgcctcgtggatgggcggtgatcgcgacggcaaccccaac
gtcactgccaagatcacccgcgaggtgctgctgctggcgcgctggatggccgctgacctg
tacctgcgcgacatcgacagcctggccgccgagctgtccatgcagcgcgccaacgacgaa
ctgcgtgcccgcgccggtgacagcgccgagccttaccgcgcggtactcaagcaactgcgc
gagcgcttgcgtgctacccgcacctgggcccacgaatccctggccgggccggtcaatccg
ccagcgcaggtgctgcacgacaacgctgaactgcgcgagccgttgctgctctgctatcgc
tctctgcacgactgcggcatgggcgtaatcgccgatggcccattgctggatttcctgcgc
cgcgtcagcaccttcgggctgttcctggtgcgcctcgacgtgcgccaggacgctacccgc
catgcctcggcgatggccgagatcaccgagtacctgggcctgggtcgctacgacagctgg
ggcgaagagcagcggctggcattcctgcaggatgaactgagcggtcgccggcccttgctg
ccggccgacttcaaccccagcgacgacaccgccgaagtgctcgccacctgccgcgaagtg
gcagctgcgccagcggcctcgctgggctcctacgtgatctccatggccggtgccgcttcg
gacgtgctcgccgtgcagctgctgctcaaggaagccgggctgcgccggccgatgcgtgta
gtgccgctgttcgaaaccctggcggatctggacaacgctgcggtggccatcgagcggctg
ctcggcctgccggactatcgcgccggcctgcagggcccgcaggaagtgatgatcggctat
tcggactccgccaaggacgccggcaccacggcggccgcctgggcgcagtaccgcgcccag
gaaagcctggtgcgcatctgccgcgagcacgatgtcgagctgctgctgttccatggccgc
ggcggcaccgtggggcgcggcggcggcccggcccacgaggcgatcctgtcgcagccgccg
ggttcggtgaacgggcgcttccgcaccactgagcagggcgaaatgatccgcttcaagttc
ggtatgccggatatcgccgagcagaacctcaacctctacctggccgccgtgctggaagcc
accttgctgccgcccccggtgccgcaggaggcctggcgcgcgcagatggacaagctggcc
gccgatggcgtggccacctaccgcggcgtggtgcgcgagcatccgcagttcgtcgagtac
ttccgccaagccacacccgagcaggaactcggtcgtctacctctgggcagccggccggcc
aagcgccgcgagggcggggtggagagcctgcgcgccatcccctggatcttcgcctggact
cagacgcgcctgatgctgcccgcctggctcggctgggaggccgctttgcgcaatgcactg
gagcgtggcgagggcgaggtgctgcgcgagatgcgcgagcagtggccgttcttccgtacg
cgcatcgacatgctggagatggtgctcgccaaggctgacgagtcgattgcccggctgtat
gacgagcgtttggtgacggccgaattgcaacctttgggtgcgcatttacgcgacctattg
tcgcaggcgagcgaggtggtgctgggcctgaccggccaatcgcagctcttggtgcacagc
cccgagaccctggaattcattacagtgcgcaacacctatctggacccgctacacctgctg
caggccgagctgctggcccgctcacggcagcgtgaacaggagcccggaagcgctctggaa
caggcgttgctggtcagtgtggcgggtattgcggcggggctgcgcaacaccggttga

DBGET integrated database retrieval system