KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c38820Help
Entry
PF1751_v1c38820   CDS       T03766                                 

Definition
(GenBank) peptide synthase
Organism
pfw  Pseudomonas fluorescens PCL1751
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4315318..4328199)
Genome map
AA seq 4293 aa AA seqDB search
MMDAFELPPTLVQSLQRRAAQTPDQVALRFLAESAEHSVVLSYRDLDQRARTIAAALQAN
ADLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQARLLSIISDAEPRLL
LTIASLADGLSQLENAPPVLSVDRLEGAGNWVAPDLHPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSETALERLDLSRWRVAYSGSEPIRLDTL
ERFAEKFAACGFTPNHFFASYGLAEATLFVAGGSRGQGIAAMRVDDQALAANRAEPGQGS
AIMSCGTRQPEHAVLIADPHTLAELPDNHVGELWATGPSIAHGYWRNPEATAKTFVQHAG
RRWLRTGDLGFIRDGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAV
NEQGLEGIGIAAEISRSVQKILAPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTSSG
KLQRAACALRHKDGSLDSYAQFPNLHAQEGDGALESELHNQIAAIWCEQLQVATVAADDH
FFLLGGNSITATQVVARLRERLGLELNLRMLFEAPTLEGFAASVAQLQQDGGVAQGAIHS
LSRQEELPQSLAQSRLWITWQLDPHSSAYTIPGALRLRGELDEDAVRTSFQQLIQRHEAL
RTRFYERDGQAFQCVDTKADFDLQVIDLSDLPVAEREARAQQIREDEARTQFDLEKGPLL
WVTLVRLDDEDHQLLVTLQHIIADGWSLNILMDEFSRLYAAAVQGQTLELPPLALQYADY
GTWQRQWLAEGEGQRQLAYWKAQLGEEHPTLSLATDHPRSVHHRHSASRHTVRLGASLSE
AIRQTARTHESTPFMLLLAAFQSVLYRYSGQRDIRIGVPNANRPRQETQGLVGFFINTLV
LRAELDGRLPFTELLAATRQAALGAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRDL
SALRRLPGMLADELPWHSREAKFDLQLHTEEDRNGRLSLSFDYADELFESATIQRLAEHY
INLLHAICEQPRQAIGDLMLMQHDEQALYSEAPCAPAQVWLPELLNQQTSDTTALVWGGG
SLTFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDPDY
PTERLAYMLKDSGVHLLLTQTALLEQVPAACGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGITHAALAERLQWMQATYPLNETDVLMQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLVAECTSLRRLFS
GGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCRAEDGERSPIGRPLGNVICR
VLDEQLNPVPLGVPGELCIGGIGLARGYLGRAGLTAERFVADHQGARLYRTGDRARWSAD
GVIEYLGRLDQQVKLRGFRVEPEEIEARMLALEGIAQAVVLVRDGQLIGYFTAHGDLDEQ
QVKTALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWQVREHVEPETPLQQQIA
AIWREVLGLPSIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFDASELGAFAEQ
VGLIQASGQRNQQTVIAKVDRGQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVLD
VGRFEAALQALIMRHETLRTTFPSVDGVAYQNVSPQTGLRMDWQDFSALSEADRQPRLQR
LADHEAHTPFNLETGPLLRACLVKAGEQEHYLVLTLHHIVTEGWAMDIFARELSALYEAF
IDERDSPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWTAQLGNEHPLLELPGDRPRPPV
QSHQGELYRFDLSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVAN
RIRPESEGLIGAFLNTQVLRCQLNGQMNVAELFEHVRHTVIEGQSHQDLPFDHLVEALQP
PRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRLGCC
LTYSTDLFDEPRIARMAAHWRNLLEALIADPQQRLSELPLLGADEQRVLQDSLGIENGEH
RLDQCIHPLFSQQVAARGDAPALTFAGVTLSYRELDARANRLAWMLRERGVGPQVRVGLA
LPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFEALGELPA
TVACWCLEDDLPVLANYPADALPFISLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCAA
VIERFGMRADDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICGLIRTHGI
NILGFTPSYGSQLAQWLATRQQTLPVRMCITGGEALTGEHLQRIRAAFQPQVFFNAYGPT
ETVVMPLASLAPEHLEEGAASVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAGLAQ
GYHQRPGMTAERFVADPFARNGGRLYRTGDLVRQRVDGLVEYLGRIDHQVKIRGFRIELG
EIETRLLEHDAVREAVVLALDAPSGKQLVAYLVSDAEHVALRDALKAHLKAHLPDYMVPA
HLIVLDSMPLTANGKLDRRALPQPDPEANRQHYVAPRNELESTLAAIWCAVLNVQQVGLD
DNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRSEQVTAEQGLLTG
SSGLTPIQHWFFDTETPNRQHWNQALVLKPLQLLDPQRLEQALLAVLEHHDALRLSFSKR
DAQWHAEHRAVPQGGVLMQAQVRDMAHCTALFTDTQRSLDLEHGPLLRALLVDGPEGQQR
LLIAIHHLVVDGVSWRVLLEDLQTVYRQLNDGQSVSLPAKTSALRDWAARLKAYAGSESL
REELSVWQHQLAGPDAALPVARPQGSLRNRDADTVSVRLDAEHTRQLLQQAPSAYRTQVN
DLLLTALARVLCRWSGHACALIQLEGHGRETLFDDIDLTRSVGWFTSAYPLRLTPQTGQG
DSIKAIKEQLRAVPHKGLGYGVLRYLADDLCKQTLAALPSAQITFNYLGQFDQSFGADAL
FHPLDESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRERHDQQSIHELADAYLTEL
QSLVAHCLEDDAGGLTPSDFPLAHLTQAQLDSLPIAASAIEDVYPLTPMQEGLLLHTLLE
PGTGLYYMQDRYRINSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHTPGSTP
IEYLDWSDDPEDQQEPRLQALLKQEREAGFDLLNQAPFHLRLIRVGAERYWFMMSNHHIL
IDAWCRSLLMNDFFELYMALGEGRDAQLATPPRYRDYIAWLQRQNLNEARQWWQQNLQGF
ERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLDARDGAQLRELAQAHQLTVNTFAQAAWA
LVLRRLSGDRDVLFGVTVAGRPVEMPEMQRTVGLFINSIALRVKLPEDGQACSVRQWLSE
LLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDS
GRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALVQGFQGDMADL
PLIGEQEREFLVDGCNQSEHDYPLERSYIELFEEQVAAHPQRIAASCLDQQWTYDELNRR
SNGLGHALIAAGVGLDQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPSQRLRSILD
LSRTPLLVCTEASREQAIELLDGFDCQLLVWEEIPARGENPGVYSAPDNLAYVIYTSGST
GLPKGVMVEQRGMLNNQLSKVPYLALSDADVIAQTASQSFDISVWQFLAAPLFGARVDIV
PNTIAHDPQGLLEHVQAQGITVLESVPSLIQGMLAQDRIGLDGLRWMLPTGEAMPPELAH
QWLQRYPEIGLVNAYGPAECSDDVAFYRVDLASTRGTYLPIGTPTDNNRLYLLDGALELV
PQGAVGELCVAGTGVGRGYVSDPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYV
GRVDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGMNGKHLVGYLVAADEALNPSE
RLDRIKQRLRAELPEYMVPLHWLWLDRLPLNANGKLDRKALPALEIGQLQSQDYLAPRNE
LEATLAAIWAEVLKVERVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMFECSTV
AELAEYIDGLAANEVSAEKVDRLSDLMAELEGL
NT seq 12882 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccctaccctggtccagtcccttcaacgtcgcgctgcg
cagaccccggaccaggtcgccttgcgcttcctcgccgagtccgccgagcacagcgttgtg
ctcagttatcgcgatttggatcagcgtgcccgcaccatcgccgccgccttgcaggccaat
gcggacctgggcgaccgtgccgtgctgttgttccccagtggcccggattatgtcgcggcg
ttctttggttgcctgtacgcgggtgtgatcgcggtgccggcctatccgccggagtccacc
cgtcgccaccatcaggcgcgcctgctgtcgatcatcagcgatgccgaaccgcgtctgctg
ctgaccatcgccagcctcgccgatggcttgtcgcagctcgaaaatgcgccgcccgtattg
agcgtcgatcggctggaaggtgccggcaattgggtcgcccctgacctgcatccggacgac
atcgccttcctgcaatacacctcaggttccaccgcgttgcccaagggcgtgcaagtcagc
cacggtaacctggtggccaacgaagtgttgatccgtcgcggtttcggcatcgacctgaac
cccgatgacgtgattgtcagttggctgccgctgtaccacgacatggggctgattggcggt
ctcctgcaaccgatcttcagtggtgtgccctgcgtgctgatgtcgccggcctacttcctc
gggcgaccgttacgttggctggaagcgatcagtgaatacggcggcaccatcagcggcggt
ccggacttcgcctatcgcctgtgcagcgaaagggtcagcgagaccgcgttggagcgcctg
gatttgagccggtggcgcgtggcctattccggctccgagccgattcgcctcgacaccctg
gaacgcttcgccgagaagttcgccgcctgcggttttaccccgaaccatttctttgcctcc
tacggcctggccgaggcgaccctgtttgtcgcgggcggcagccgtggccagggcattgcg
gcgatgcgcgtcgacgatcaggccctggccgccaatcgcgccgagccggggcagggcagt
gcgatcatgagctgtggcacccgccagccggaacacgcggtgctgatcgctgacccgcat
acccttgccgagctgcccgacaaccacgtcggcgaactctgggccacgggtccgagcatc
gcccacggctactggcgtaaccccgaagccaccgcaaagacctttgtgcaacatgccggc
cgtaggtggctgcgtacgggcgacctgggcttcatccgtgacggtgaggtgtacatcacc
ggtcgcctcaaagacctgctgatcgtgcgcggccacaacctgtacccacaagacatcgag
cagaccatcgagcgcgaagtggaggtggtacgcaaaggccgggtcgccgcatttgcagtg
aatgagcagggcctggaaggcatcggcattgccgctgaaatcagccgcagtgtgcagaaa
atcctggcgcccgaggcgctgatcaaggcgattcgccaagccgtcgccgaggcgtatcaa
gaggcgccaagcgtggtggtgctgctcaaccctggcgccttgccgaagacctccagcggc
aagctgcagcgcgcggcctgtgcgcttcgtcacaaggacggtagcctcgacagctatgcg
cagttcccgaacctgcacgcgcaggagggcgatggggcgctggaatccgaactgcacaac
cagattgcggcgatctggtgcgagcagttgcaggtggcgacggttgcggccgatgaccac
ttcttcttactcggcggcaactccatcaccgccacccaggtggtcgcacgcctgcgcgaa
cgcctcggcctggagcttaacctgcgcatgctgttcgaagcaccgaccctggaaggcttt
gccgccagcgttgcgcagttgcagcaggacggcggcgtcgcccaaggcgcgatccacagc
ctgtcgcgccaagaggaattgccccaatccctggcacagagccgcctgtggatcacctgg
caactggacccccacagcagcgcctacaccatccccggcgccctgcgcctgcgcggcgag
ctggatgaagacgcggtgcgtaccagcttccagcaactgatccagcgccacgaagccctg
cgtacacgcttctacgagcgcgacggccaggctttccagtgtgtcgataccaaggccgat
ttcgacctgcaagtcatcgacctcagcgacctgcccgttgccgagcgcgaagcccgtgcg
caacagatccgcgaagacgaagcgcgcacccagttcgacctggaaaaaggcccgctgttg
tgggtgaccctggtgcgcctggacgatgaagatcaccaactgttggtgacgctgcaacac
atcatcgccgacggctggtcgctcaatatcctgatggacgagttctcacgcctctatgcc
gccgccgtccagggccagacactggagctgccgcccctggccctgcaatacgccgactac
ggcacttggcagcgccaatggctggccgaaggtgaaggccagcgtcaactggcgtactgg
aaagcgcagttgggtgaagagcatcccaccctgagcctggcgaccgaccacccgcgctcg
gtacaccaccgtcacagtgcctcacgtcacactgtgcgccttggcgcgagcctcagcgaa
gccattcgccagaccgcccgtacccacgagtccaccccgttcatgctgttgctggcagcc
ttccagagcgtgctctaccgttacagcggccaacgcgatatccgcatcggcgtgcccaac
gccaaccgcccgcgccaggaaacccaaggcctggtcggcttcttcatcaacaccttggtg
ctgcgcgccgagctggatgggcgcttgcccttcactgaactgttggccgcgacacgccag
gctgcgctgggcgcccaggcccatcaggatttgccattcgaacaactgctggaggccttc
ccgcaggcccgcgagcagggcctgttccaggtcatgttcaaccaccagcaacgcgacctc
agcgccttgcgccgcctgccgggcatgctcgccgacgagttgccgtggcacagccgcgaa
gccaagttcgatttgcaactgcacaccgaagaagaccgcaacgggcgcctgagcctgtcg
ttcgactatgccgatgaactgttcgaaagcgcgaccatccagcgcctcgccgagcactac
atcaacctgttgcacgccatctgcgaacagccccggcaagccatcggcgacctcatgctg
atgcagcacgacgaacaagccctttacagcgaagcaccctgcgcaccggcccaagtgtgg
ctgcccgaactgctcaaccagcagacctcggacaccaccgcgctggtctggggcggcggc
agcctgaccttcgcccaattgcacacccaggccaaccgcctggcccattacctgcgtgac
aaaggcgtcggcccggacgtgtgcgtggccatcgccgccgaacgttcgccgcaactgttg
atcggcttgctggcgatcatcaaggccgggggcgcttacgtgccgctggacccggattac
cccaccgagcgcctggcctacatgctcaaggacagcggcgttcacctgctgctgacccag
accgcgctgctggagcaggtgccggctgcctgcggcgtgtgcgtcatcgccatggacagc
ctgcacctggacagttggcccacccagccgcccggcctgcatttgcacggtgataacctc
gcctacgtgatctacacctccggttccaccggccagcccaaaggcgtgggcatcacccat
gccgcgctggccgagcgcttgcagtggatgcaggccacttatccactcaacgaaaccgac
gtgctgatgcagaaggcaccgatcagtttcgacgtgtcggtgtgggaatgcttctggccg
ctgatcactgggtgccgcctggtactggccgggcccggtgagcatcgcgacccgcatcgg
atcgcgcagttggtgcaggaacacggcgtgaccacgctgcacttcgtgccgccgctgttg
cagttgtttatcgacgaaccgctggtggccgaatgcaccagcctgcggcgcttgttctcg
ggcggggaagccttgcccgccgaactgcgcaaccgcgttctggcccagttgccagccgtg
caattgcataaccgttatggtccgaccgaaaccgcgatcaacgtgacccactggcactgt
cgcgcagaagacggcgagcgctcgccgattggtcggccactgggcaacgtgatctgccgc
gtgctggatgagcagctcaaccccgtgccgctgggcgtgccgggtgagctgtgcatcggc
ggtatcggcctggcccggggttaccttggccgcgccgggttgacggctgagcgttttgtc
gccgatcaccaaggcgcccgcctgtaccgcaccggtgaccgcgcccgttggagcgccgac
ggtgtgatcgagtacctcgggcgtctcgaccagcaggtcaagctgcgcggcttccgtgtg
gagccggaagaaatcgaggcgcgcatgctcgccctggagggcatcgctcaagctgtggtg
ctggtgcgtgacgggcagttgattggctacttcaccgcccatggcgacctggacgaacaa
caggtcaaaaccgccctggccgcggagttgccggaatacatggtgcccgcgctgctgatg
cgcctggacgccatgccattgagccccagcggcaagctggaccgccgcgcgttgccggag
ccggtgtggcaagtgcgtgaacacgtcgaacccgaaacgccgctgcaacagcaaatcgcc
gcgatctggcgcgaagttctcggtctgccaagcattggtctgcgcgatgacttcttcgcc
ctcggcggccactcgttgctggccacgcagatcatttcccgcacccgccaggcctgtgat
gtggaactgccgttgcgcaccttgttcgacgccagtgaactgggggcgtttgccgagcag
gtcggcctgatccaggcctcgggacaacgcaaccaacagaccgtcatcgccaaggtcgac
cgcggccaacccgtgccgctgtcctattcccagcagcgcatgtggttcctgtggcagatg
gaaccggacagcccggcctacaacgtcggcggcatggcgcgtttgcgcggcgtgctggac
gtggggcgtttcgaggcggcgctgcaagcgctgatcatgcgtcacgaaaccctgcgcacg
acgtttccgagcgtcgatggtgtggcttatcagaacgtttcgccgcagaccgggctgcgc
atggattggcaggatttctccgcgctgagcgaagccgaccgtcaaccgcgcctgcagcga
ctggctgatcatgaggcacacacgccgttcaacctggaaaccgggccgttgttgcgtgcg
tgcctggtcaaggccggcgagcaggaacactacctggtgctgaccctgcaccatatcgtc
accgaaggctgggccatggacatctttgcccgtgaactcagcgcgttgtacgaggccttt
atcgacgagcgcgactcgccgctggcgccgctgcccgtgcaatacctcgactacagcgtg
tggcagcgtcagtggctggagtccggcgagcgccagcgtcagctggattactggactgcg
caactgggcaatgaacacccgctgctggaactgcccggcgaccgtccacgcccgcctgtg
caaagccaccagggcgagttgtaccgcttcgacctcagcgacgacctcgctgcccgcgtg
cgtgccttcaatgccgagcgcggcctgaccctgttcatgaccatgaccgccaccctggcc
gtgctgctctaccgttatagcggccagaccgacttgcgtatcggcgccccggttgccaac
cgtatccgtcctgaaagcgaaggcttgattggtgccttcctcaacacccaggtgctgcgg
tgccagctcaatgggcagatgaatgtcgctgagttgttcgagcacgtgcgccacaccgtg
atcgagggtcagtcccatcaagacctgccgttcgatcacctggtggaggccctgcaaccc
ccgcgcagcgcggcgtacaacccgctgttccaggtgatgtgcaacgtgcagcgctgggaa
ttccaacagagccgccaactggccggcatgaccgtcgaatacctggccaacgatgcgcgg
gcgaccaagttcgacctcaacctggaagtcaccgacctcgaccatcgcctgggttgctgc
ctgacctacagcactgacctgttcgacgagccacgcattgcgcgcatggccgcccattgg
cgcaatctgctggaagccttgatcgcggatccgcagcaacgcctcagcgaattgccgttg
ctgggtgcggatgaacagcgtgtgttgcaagacagcctgggcattgagaatggcgagcac
cgtctcgatcagtgcatccacccactgttcagccagcaggtggcagcccgtggcgatgcg
ccggcgctgacctttgccggcgtgaccctcagctaccgagaactcgacgcccgcgccaac
cgcctggcctggatgctgcgcgaacgtggcgtcggcccgcaggtgcgtgtcggcctggcg
ttgccgcgctccctggaaatggtcatcggcctgctggcgatcctcaaggccggcggtgcc
tatgtgccgctggacccggaatacccgctggaccgcctgcactacatgatcgaagacagc
ggcatcggcctgctgctcagcgatgcggcgatgttcgaggccctcggcgagttaccggcc
actgttgcgtgctggtgtctggaggatgacttgccggtgctggccaactacccggccgat
gcgctgccgtttatcagcctgccgcaacaccaggcgtacttgatctacacctccggctcc
accggcaagccgaaaggcgtggtggtatcccacggtgaaatcgccatgcattgcgcggcg
gtgatcgagcggtttggcatgcgcgcggatgactgcgagctgcacttctattcgatcaac
ttcgatgcggccaccgagcgtctgctggtgccgctgctcagtggcgcacaggtggtgttg
cgggctcaggggcagtgggatgccgaggaaatctgcggattgatacgcacccatggcatc
aacatcctgggcttcaccccgagctacggcagccagttggcgcagtggttggcgacccgg
cagcagaccttgccggtgcgtatgtgcattaccggcggcgaagccctcaccggcgaacac
ttgcagcgcatccgtgccgcgttccagccgcaggtgttcttcaacgcctatggcccgact
gaaaccgtagtgatgccgctggccagcctggcgcccgagcacttggaggagggcgccgcc
agcgtgccgatcggcagcatcatcggtgaccgcgtggcttatattctcgacgccgacctg
gccttggtgccgcaaggcgcgaccggcgagttatacgtgggcggtgcgggtctggcgcag
gggtatcaccagcgtccgggcatgaccgccgaacgttttgtcgcggacccgtttgcgcgc
aacggcgggcgcctgtaccgcaccggtgacctcgtgcgccagcgcgtcgatggcttggtg
gagtacctcgggcgtattgaccaccaggtgaaaattcgcggtttccgtatcgaactgggc
gagatcgaaacccgcctgctggagcatgacgccgtgcgcgaagcggtggtgctggcgctg
gatgcgccgagcggcaaacagttggtggcgtatctggtcagcgatgccgagcacgtcgcg
ctgcgtgatgcgctgaaggcccatctcaaggcgcacctgccggactacatggtgcccgcg
cacctgatcgtgctggacagcatgccgctgaccgccaacggcaagctcgaccgccgtgcc
ttgccgcagccggatcccgaagccaaccgccaacactacgtggcaccccgcaacgaactg
gaaagcaccctggcggcgatctggtgcgcggtgctgaacgtgcaacaagtcggcctggac
gataacttcttcgagctggggggcgactcgatcctgtcgatccaggtggtcagccgtgcg
cggcaggccgggattcatttcagccctcgcgacctgtttcagcaccagaccgtgcagacc
ctggctgctgtggctacgcgctccgagcaggttacggcagagcagggcctgctgaccggc
agttcgggtctcacgccgatccagcattggttcttcgacaccgagaccccgaaccgtcag
cactggaaccaggcgctggtcctcaagccgctgcagttgctcgacccccagcgcctggaa
caagcgctgctggcggtactggaacaccatgacgccttgcgcctgagcttctccaagcgc
gacgcccaatggcacgccgaacacagggccgtgccgcagggcggcgtgctgatgcaggcg
caagtgcgtgacatggcgcactgcaccgcgctgttcaccgacacccaacgcagcctcgac
ctggagcacggcccgctactgcgcgccttgctggtggacgggcccgaggggcagcaacgc
ctgttgatcgcgatccatcacctggtggtggacggcgtgtcgtggcgtgtattgctggaa
gatctacaaacggtttatcgccagttgaacgatggccagtccgtcagcctgccggccaag
accagtgccctgcgtgattgggccgcgcgtttaaaggcgtatgccggtagcgaatccttg
cgtgaggaattgagcgtctggcagcaccagttggccggccctgacgccgcattgccggtg
gcccgcccacaagggtcgctgcgcaaccgcgatgccgacaccgtcagcgtgcgcctggat
gccgaacacacccgccagttgctgcagcaagccccaagcgcctaccgcacccaggtcaac
gacctgttgctgaccgccttggcccgcgtgttgtgccgctggagcggtcacgcttgcgcg
ttgatccaactggaaggccacggccgcgaaaccctgttcgatgacatcgacctgacccgc
agcgtcggctggttcaccagtgcctatccgctgcgcctgaccccgcaaaccgggcagggc
gattcgatcaaggcgatcaaggaacaactgcgcgccgtgccgcataaaggcttgggctat
ggcgtgctgcgctacctcgccgatgacctgtgcaagcagaccctggccgcactgccgagc
gcgcagatcaccttcaactacctcggccagttcgaccagagcttcggcgccgatgcgctg
ttccacccgctggatgaatccgccggcctggcccatgacccggacgcgccgctgcccaac
gagttgagcgtcgacagccaggtgtatggtggtgagctggtgctgcgctggaccttcagc
cgcgaacgccacgatcaacagagcatccatgaactggccgatgcctacctcaccgagctg
caaagcctggttgcacattgtctggaggacgacgccggtggtcttacaccgtccgacttc
ccgctggcgcacctgacccaggcgcaactcgacagcttgccgattgccgccagcgccatc
gaagatgtctacccgctgaccccgatgcaggaaggcctgctattgcacaccctgctggag
cccggcaccggcctctactacatgcaggaccgctaccgcatcaacagcgccctggacccc
gagcgtttcgcccaggcctggcaggcggtgatcgcccgccacgaagccctgcgcgcgtcg
ttctgctggaacgtcggcgaagacatgctgcaagtgatccacacacccggcagcacgccg
attgagtacctggactggagcgacgatccggaggaccagcaggagccgcgcctgcaagcg
ctgctcaagcaagagcgcgaagccggcttcgatctgctcaaccaggcaccgttccacctg
cgcctgatccgcgtcggcgccgagcgttactggttcatgatgagcaaccaccacatcctt
atcgatgcctggtgccgttcattgctgatgaatgacttcttcgagctctacatggccctc
ggtgaaggccgcgacgcgcaactggccacgccgccgcgctaccgcgactacattgcctgg
ctgcaacgccagaacctcaatgaggcacgccaatggtggcaacagaacctgcaaggcttc
gagcgcaccacgccaatcccgagcgaccggccgttcctgcgtgaacacgcgggccacagc
ggcggcatggtggtgggcgattgctacacccgtctcgatgcccgcgacggtgcacaactg
cgcgaactggcacaggctcaccaactgaccgtcaacaccttcgcccaggcggcgtgggcg
ctggtgctgcgccgtttgagcggcgatcgcgacgtgctgttcggtgtcaccgtggccggg
cgcccggtggaaatgcccgagatgcaacgcaccgtcggcctgttcatcaacagcatcgcc
ctgcgggtgaaactgcccgaggacggtcaagcgtgcagcgtgcgccagtggttgagcgaa
ctgctcgacagcaatatgcaactgcgcgagtacgagtacctgccgctggtgacgatccag
gaacacagcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgaaaac
gccccggtggaagtctcggtgctggaccgtgcacaaagcctgaacgccacctcggattcc
ggccgcacccacaccaacttcccgctgaccgccgtgtgctatccaggtgatgacctgggg
ctgcacctgtcctacgaccaacgctacttcgacgaaaccaccgtgcaaggcatgctcggc
gagttcaagcgcctgctgctggcgctggtccaaggcttccagggtgacatggccgacctg
ccactgattggcgagcaggagcgtgagttcctggtggacggttgcaaccagagcgagcac
gactacccgctggagcgcagctacatcgagctgttcgaagagcaggtcgccgctcatccg
cagcgcatcgccgccagttgcctcgaccagcaatggacctatgacgaactgaaccgtcgc
agcaacggcctgggccacgcgctgatagctgcgggtgtcggcctggatcaaccggtggcg
ttgttggccgagcgtaacctcgacctgctcggcatgatcatcggcagcttcaaggccggt
gccggctacctgccgctggaccccggcctgccgagccagcgcctgcgcagcatcctcgac
ttgagccgcacgccattgctggtgtgcaccgaagcatcccgtgagcaagccatcgagttg
ctggacggttttgactgccagcttctggtgtgggaggaaatacccgcgcgtggtgaaaac
cccggtgtctacagcgctccggataaccttgcctacgtgatctatacctccggttccacc
ggtctgcccaagggcgtgatggtggaacagcgcggcatgctcaataaccaactgagcaaa
gtgccgtacctggccttgagcgacgcggatgtgattgcgcaaaccgcgtcgcagagcttt
gatatttccgtatggcagttcctcgctgcgccgctgttcggcgcgcgggtggacatcgtg
ccgaacaccatcgcgcatgatccccaaggcctgctggaacatgtccaggcccagggcatc
accgtgttggaaagcgtgccgtcgttgatccagggcatgcttgcacaagaccgcatcggc
ctggatggcctgcgctggatgctgccgaccggcgaagcgatgccaccggaactggcgcac
cagtggttgcagcgttatccggagattgggctggtcaacgcttacggcccggcggagtgt
tcggacgatgtggcgttctatcgtgtcgacctggcgtctacccgaggcacctatttgccg
attggtacgcccaccgacaacaaccgtttgtacctgctggatggcgcactggaactggta
ccgcaaggcgcggtgggtgagttgtgcgtggccggcacgggtgtcggtcgcggttacgtc
agcgacccgctgcgcaccgcgcccgtatttgtgccgaaccccttcggcgcaccgggcgaa
cgtctctaccgcaccggcgacctcgcgcgccgtcgcagtgacggcgtgctggagtacgtc
ggacgtgtcgaccaccaagtgaagattcgcggctaccgcatcgaactgggtgaaatcgaa
gcgcgcctgcacgaacaaccggaagtgcgcgatgcggcggtgggcgtgcaggaaggcatg
aatggcaagcacctggtcggctacctggtggcggcggatgaagcactgaacccaagcgaa
cgcctggaccgcatcaagcaacgcctgcgcgccgaactgccggaatacatggtgccgctg
cactggctctggctcgaccgcctgccgctcaacgccaacggtaaactcgaccgcaaggcg
ttgccggcgctggagatcggccagctgcaaagccaggactacctggcaccgcgcaacgaa
ctggaggctacgttggccgccatctgggccgaggtgctgaaagtcgagagggtaggggtg
caggacaacttcttcgaactgggcgggcactcgttgctggccacgcagattgcctcgcgg
gtgcagaagaccctgcaacgtgatgtgccgctacgcgcaatgttcgagtgcagcacggtg
gcggaattggccgagtatatcgacgggctggcagccaatgaggtcagtgccgagaaggta
gatcggttgagtgatttgatggcggagttggaggggttgtga

DBGET integrated database retrieval system