KEGG   Pestalotiopsis fici: PFICI_00682Help
Entry
PFICI_00682       CDS       T04924                                 

Definition
(RefSeq) Histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pfy  Pestalotiopsis fici
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pfy00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PFICI_00682
Enzymes [BR:pfy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PFICI_00682
Chromosome [BR:pfy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PFICI_00682
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PFICI_00682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 335 aa AA seqDB search
MEEWSKHHFFHHGKPSREAEKRNCHWCQIRRFKTHPEFPVTIINRMDQIVPDPEFRFIDH
SVFGAGVEPTKDEFRSGCDCEDGMDCQYRDCHCLQEMYDSEDVDEEDGDYGDLTQRKSYA
YHTHGTKKGHLRSKVLESREPIYECHDGCSCGPDCPNRVVERGRQIPLQIFRTPNRGWGV
RSMVDIKRGQFIDKYIGEVITPQEADRRRARSDIAQRKDVYLFALDKFSDPDSPDERLRG
PPLEVDGEFMSGPTRFINHSCDPNLRIFARVGDHADKHIHDLALFAIVDIPKGDELTFDY
VDGVDDSENDALDPTKKKDMTVCLCGSSKCRGFLW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatggagcaagcatcacttcttccaccacggcaagccaagccgtgaggccgaa
aagagaaattgtcactggtgccaaattcgccgcttcaagactcaccccgaattcccggtc
accattatcaaccgcatggaccaaatcgttcccgaccctgaatttcgcttcattgaccac
tccgtcttcggcgccggtgtcgagcctaccaaagacgagtttcgtagcggctgcgactgc
gaggatggcatggattgccaatacagagactgccactgcctgcaagagatgtatgactcc
gaggacgtggatgaggaagacggagactatggcgacctgacgcaacgaaaatcatacgca
taccatacccacggcacaaagaagggacacctgcggtccaaggtcctcgagtcacgggaa
cccatatacgaatgccacgacggttgctcatgtggtccagactgcccaaaccgtgtggtg
gaacgaggccggcaaattcccctgcaaatcttccgcacccctaaccgaggctggggcgtc
agaagtatggtagacatcaaaagaggccaattcatcgacaagtacattggcgaggtcatc
acaccccaagaggcggaccgtagaagagctcggtccgatattgcccagcgcaaggacgtg
tacctcttcgccctggataaattctcggatccagactcgccagacgaaaggctgagagga
ccgcctctcgaagttgacggagaattcatgtcaggcccgaccagattcatcaaccactct
tgcgatcccaatctgcggatttttgccagagtcggcgaccatgcagataaacatattcac
gatcttgccttgttcgccattgtggacataccaaagggtgacgaattgacgtttgattat
gtggatggggtcgacgattcggaaaacgatgccctagacccgacaaagaagaaagatatg
accgtatgcctatgcggtagttcaaaatgtcgcggctttctgtggtga

DBGET integrated database retrieval system