KEGG   Pestalotiopsis fici: PFICI_07322Help
Entry
PFICI_07322       CDS       T04924                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00020  Citrate cycle (TCA cycle)
pfy00310  Lysine degradation
pfy00380  Tryptophan metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
pfy01200  Carbon metabolism
Module
pfy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfy00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PFICI_07322
  Amino acid metabolism
   00310 Lysine degradation
    PFICI_07322
   00380 Tryptophan metabolism
    PFICI_07322
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PFICI_07322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YceG_bac
Motif
Other DBs
NCBI-GeneID: 19272335
NCBI-ProteinID: XP_007834094
UniProt: W3X8G0
LinkDB All DBs
Position
Unknown
AA seq 1047 aa AA seqDB search
MLSSSLRRCSGSLLRASNQASTRCASAARSSRCFSSVSAARRPLAVSATQKRYASAQAQS
PDPNDNFLSGSTANYIDEMYMQWKEDPQSVHVSWQVYFKNMESGDMPIAQAFTPPPNLVH
SATGGVVSSQLGGVAAGQGSDITNHLKVQLLVRAYQARGHHKARIDPLNIRGEGKGFSDI
KPKELNLDHYQFTEKDLDTEFELGPGILPRFKREGREKMTLREIVAACEKIYCGSYGVEF
IHIPDRAKCDWLRERVEVAQPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKRFGLEG
CETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTAGAEDE
GSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEKTHRT
AMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARSTAYCT
DIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQSDVVIDMVCYRKHGHNETDQPSFT
QPLMYKRISEKEPQIKIYADKLLEDGTFTKEDVEEHKQWVWGMLEESFAKSKDYQPSSKE
WTTSAWNGFKSPKELATEVLPHNSTAVDKKTLEHIGEVIGTAPEGFHVHRNLKRILQNRT
KSVLEGKNIDWSTAEALAFGSLVTEGHHVRISGQDVERGTFSQRHAVFHDQETEDSYTPL
QHVSKDQGKLVISNSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIA
SGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPRIFPSEEKLHRQHQDCN
MQIAYMTTPANLFHILRRQMHRQFRKPLIIFFSKSLLRHPLARSSIEDFTGPDAQFQWII
PDPEHQTGAIKNPEEIERVILCSGQVWATLSKYRADNKIDNVAFTRIEQLNPFPWQQLKD
NLDMYPNAKTVVWCQEEPLNAGAWSFVQPRIETLLNHTQHHDRKHVMYAGRNPSASVATG
LKAAHKKEEEDFLEMAFSVTQDKLKGE
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcagttctctacgcagatgcagcggctcgctgctgcgcgcctccaaccaagcc
tccacacgatgcgcctccgctgcccgtagctcgagatgcttctcttccgtctctgctgcc
cgtaggcctctcgccgtctctgccacccagaagaggtacgcctcggcgcaggctcagtcg
cccgaccccaacgacaacttcctgtccgggagcactgccaactacattgacgagatgtac
atgcagtggaaagaagacccccagagcgttcacgtatcatggcaggtctacttcaagaac
atggagagcggtgatatgcccattgctcaggccttcacgccgccgccaaatctggtccat
agcgctaccggtggcgtcgtctcgagtcaactgggaggcgtcgccgccggccagggttcc
gacatcaccaaccatctcaaggttcagcttctcgtgcgcgcgtaccaagcccgcggtcac
cacaaggctcgtatcgaccctctcaacatccgtggcgagggcaagggcttcagtgacatc
aagcccaaggagttgaacctcgaccactaccagttcaccgagaaggatcttgacaccgag
ttcgagctgggtcctggtattctaccccgtttcaagcgtgagggccgcgagaagatgacc
ctgcgcgagatcgtggctgcctgtgagaagatctactgcggttcctacggtgtcgagttc
atccacattcccgaccgtgccaagtgcgactggctccgagagcgtgtcgaggtcgcccaa
cccttcaagtactcgatcgatgagaagcgccgaatcctcgaccgtctcatctggagctcc
agctttgagtccttccttgccaccaagtaccccaacgacaagcgtttcggtctcgaaggt
tgcgaaactcttgtccccggcatgaaggctctcatcgatcgcagcgttgactacggcgtc
aaggacattgtaattggtatgccccaccgtggtcgtctgaacgttttgagcaacgttgtt
cgcaagcccaacgagtccatcttcagcgagttcgccggtactgccggcgccgaagacgag
ggttcgggcgatgtcaagtaccatctgggtatgaactttgagagacctactccctccgga
aagcgtgtccagctctcgctggttgccaacccatcgcatttggaggctgaggaccctgtc
gtcctcggcaagactagagccatccagcactacaacaacgatgagaagacccacaggact
gccatgagtgttctccttcacggtgacgctgcatttgctgcccagggtattgtctacgag
tgtcttggtttccactccctgcccgccttctccaccggcggtaccattcatctggttgtg
aacaaccagattggtttcacgaccgatcctcgattcgcccgctccactgcctactgtacc
gatattgccaaggctattgacgccccagtgttccacgtcaacgccgatgatgtcgaggcc
gtcaactttgtctgccagcttgccgcagattggcgcgccgagtttcagtccgacgtggtc
attgacatggtctgctaccgaaagcacggacacaacgagactgaccagccgtccttcact
caacccctcatgtacaagaggatcagcgagaaggagccccagatcaagatttacgccgac
aagctgctcgaggatggcaccttcaccaaggaggacgttgaggaacacaagcaatgggtc
tggggcatgctggaggagagctttgcaaagtccaaagactaccagccctcgtccaaggag
tggactacatcggcctggaacggattcaagtcccccaaggagttggccacggaagtcctg
cctcacaactccaccgccgtggacaagaagactttggagcatattggtgaggtcattgga
actgctcccgagggcttccacgtgcaccgcaacctgaagcgtatccttcagaaccgcacc
aagtcggtccttgagggtaagaacatcgactggtcgacagccgaagccctggctttcggt
tccctggttactgaaggtcatcacgttcgtatctctggccaggacgtcgagcgtggcacc
ttctctcagcgccatgccgtcttccacgaccaggagactgaggactcgtacacacccctg
cagcacgttagcaaggaccagggcaaactggtcatttccaactcgtccctgagtgagttt
ggtgcccttggtttcgaatacggctactccctgtcgtctcccaatgccctggtcatgtgg
gaggcccagttcggtgactttgccaacaacgcccaatgtatcattgatcaattcatcgcc
tcgggtgaggtcaagtggatgcagagaacgggcctggtcatgtcgcttcctcacggatac
gacggtcagggccccgagcactcgtctggacgtctggagcgatacctacaattgtccaat
gaagaccccagaatcttcccgtccgaagagaagcttcatcgtcaacaccaggactgcaac
atgcagattgcgtacatgactacaccagccaacttgttccacatcctgcgtcgccagatg
cacaggcaattcaggaagcctctgatcattttcttctcaaagtctctgttgcgtcaccct
cttgctcgttccagcattgaggacttcaccggtcctgatgcccagttccagtggatcatc
cctgaccccgagcaccagactggcgccatcaagaaccctgaggagattgagcgtgtcatt
ctctgctctggccaggtttgggctactctttccaagtaccgtgccgacaacaagatcgac
aacgttgctttcactcgtattgagcagctgaacccgttcccctggcaacaactgaaggac
aacctggacatgtacccgaacgccaagaccgttgtctggtgtcaggaggagcccctcaac
gccggtgcctggagcttcgtccagcctcgcattgagactcttcttaaccacacgcaacac
cacgaccggaagcacgtcatgtacgccggtcgtaacccgtcagcctctgtggctactggc
ttgaaggctgctcacaagaaggaagaggaggactttttggagatggccttctccgtgacg
caggacaagctcaagggcgagtag

DBGET integrated database retrieval system