KEGG   Pseudomonas fragi: AV641_09015Help
Entry
AV641_09015       CDS       T04285                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pfz  Pseudomonas fragi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AV641_09015
Enzymes [BR:pfz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AV641_09015
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AV641_09015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1943739..1947086
Genome map
AA seq 1115 aa AA seqDB search
MANQPASASFIKDPLWYKDAVIYQVHIKSFFDSNNDGIGDFPGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIADYRGVHPDYGTLADVKRFIAQAHKRGLRVITELVINHTSDQHP
WFQKARRAKAGSRARDYYVWSDTDEKYDGTRIIFLDTETSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKEVLAVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHQILKQIRA
EIDAHYPDRMLLAEANQWPEDTQQYFGDSDGINGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADKRARINLGIRRRL
APLMERDRRRIELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRANPASLVLPPIMDPLYGYQSVNVEAQSGDPHSLLNWTRRLLSVRQQQQAFGRGTLKM
LSPSNRRILAYIREYTDGDGKTETILCVANVSRSAQAAELELSEFAGRVPVEMLGGNAFP
PIGQMDFMLTLAPYGFYWFLLATENQMPSWHAEPAQSLPELLTLVLKQRLEELLDTPPRT
TLENVILPAWLPKRRWFGQKNAPVEQVKILHGTRFGDALHPMLLTEVQVTSGGEQHHYQV
PLGVLGEDQASSTLAQQSVLSRLRRGPQVGFMTDAFALEAFVRAVLAGMQSGEKISSSAG
TISFTATAQLAALGLNEQSEVRYLTAEQSNSSVVIGGAMVLKLIRKISSGQHPELELGAY
LTEAGYQHISPLLGAVVRHGTGGEETLLMIAQGYLSNQGDAWTWTQNNLERAIRDEMADA
MSEHEQHYNALAELADFAGLLGQRLGEMHGVLAQASDNPDFAPQTTSEADTRQWASHING
QLKQALKLLKQHLPELGEPEQKQVKKLLAQQGAITAHVQQLAKRTQGGLKIRVHGDLHLG
QVLVVKGDAYFIDFEGEPARPLSARRSKHSPYKDLSGVLRSFDYAAAMAVSNVQQSDHSD
QADDARQRVVERYLQEARTALVDAYRQATASLAHDWKVAGGEDAALALFSLEKAAYEIIY
EAANRPAWLRVPLQGLSDLLTHLPSTAKPLPDGEK
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccaacccgcatcggccagctttatcaaggacccgctctggtacaaggacgcg
gtgatctaccaggtgcatatcaagtcatttttcgattccaataacgacggtatcggcgac
tttcccggcctgatcagcaagctggattacatcgccgagctgggggtcaacaccctgtgg
ctgctgccgttctatccctcgccgcggcgcgatgatggctacgatattgccgattatcga
ggcgtgcatccggactacggcaccctggccgacgtcaaacgctttatcgcccaggcccac
aagcgcggtctgcgggtaatcactgaactggtgatcaaccacacctcggatcaacacccc
tggtttcaaaaggcccgccgtgccaaggccggctccagggctcgggattactacgtgtgg
tcggataccgatgaaaaatacgacggcacccggatcatttttctcgacaccgaaacctcg
aactggacctgggacccggtcgccggccagtacttctggcaccgcttttactcccaccag
ccggacctgaatttcgacaacccgcaggtgatgaaagaagtgctggcggtgatgcgctac
tggctggacatgggcatcgacggcctgcgcctggatgccattccgtacctgatcgagcgc
gatggcaccaataacgaaaacctgcccgagacccatcagatcctcaagcagatccgcgcc
gaaatcgatgcccattaccccgaccgcatgctgctggcagaggccaatcaatggcccgaa
gacacccagcagtattttggcgacagcgatggcatcaatggtgatgagtgccacatggcc
ttccactttccgttgatgccgcgcatgtacatggctctggcccaggaagaccgcttcccg
atcaccgatatcctgcgccagaccccggaaattccggcgaattgccaatgggcgattttc
ctgcgcaaccatgatgagttgaccctggaaatggtcaccgacaaggaacgcgattacctg
tggaactactacgccgccgacaagcgggcgcggattaacctggggattcgtcggcgtctg
gcgccgttgatggaacgtgatcgccggcgcatcgagctgctcaacagcctgttgttatcg
atgccgggcacgccgaccctgtattacggcgatgaaattggcatgggggacaatatttac
ctcggcgaccgggacggggtgcgtacgccgatgcagtggtcgattgaccgtaacggcgga
ttctcgcgggccaacccggcgagcctggtgttaccgccgatcatggatccgctgtatggc
tatcaatcggtgaacgttgaggcccaatccggcgatccgcattcattgctcaactggacc
cggcgcctgctgtccgtgcgccagcagcaacaagcctttggtcgcggcaccttgaaaatg
ctgtcccccagcaaccggcggattctggcgtacattcgcgaatacaccgacggcgacggc
aagactgaaaccatcctctgcgtggccaacgtgtcgcgcagcgcccaggcggcagagctg
gagctgtccgagttcgccgggcgggtaccggtggagatgctggggggcaatgcctttccg
cccattggccagatggacttcatgctgaccctggcgccctacggtttttactggtttttg
ctggctaccgagaatcagatgccgagctggcacgcagaaccggcgcaaagcctgcccgaa
ctgctgaccctggtgctcaaacagcgccttgaagagttgctcgatacccccccgcggacc
actctggaaaacgtgatcctgccggcgtggttacccaaacgccgctggttcgggcaaaaa
aatgcaccagtcgagcaggtcaaaattctccacggcacccgttttggcgatgccttgcac
cccatgttgctgaccgaggtacaagtcaccagcggcggcgaacaacaccattatcaagtg
ccccttggggtattgggcgaggatcaggcaagcagcacgttggcccagcaatcggtactg
tcgcggctgcggcgtggccctcaggtcggtttcatgaccgatgcttttgctcttgaagcc
tttgtcagggccgtactggcgggcatgcaaagcggcgagaaaatcagcagcagcgccggc
actatcagttttacggccaccgcgcagctggcggccctggggctcaacgaacagagtgaa
gtgcgttatctcacggccgaacaatcaaatagctcggtggtgatcggcggcgccatggtg
cttaagctgatccgcaaaatcagcagtggccagcatccggagctggagctgggtgcctat
ctgaccgaggccgggtatcagcatatttctccgttgctgggggcagtggtgcgccatgga
accgggggcgaagagaccttgctgatgattgcccagggctatttgagtaaccagggcgat
gcctggacctggacccagaacaacctggagcgggccattcgcgacgaaatggccgacgcc
atgtccgagcacgaacagcattacaacgccctggccgaactggcagattttgccggtttg
ctcggccagcgtctgggggagatgcacggggtgctggcgcaagccagcgacaaccctgac
tttgcccctcagaccacgtccgaggccgatacccggcagtgggcaagccatatcaacggg
caattgaagcaggccttgaaactgctcaaacaacatctgcccgagcttggcgagcctgag
caaaaacaggtgaaaaaactgctggcgcaacaaggcgcgatcaccgcccatgtccagcaa
ctggccaagagaacccagggtggcctgaagatccgggtgcatggcgacctgcatctgggg
caggtgctggtggtcaagggcgatgcctacttcatcgactttgaaggtgagcctgcgcgc
ccgctgtcagcccggcgcagcaagcacagcccctataaagacctgagcggggtattgcgc
tccttcgattacgcagcggccatggcggtcagcaacgtgcaacagtcggatcactcggat
caggctgacgatgcacggcaacgggtggttgaacgctatttgcaagaagcccggacagca
ttggtcgatgcataccggcaagcaacagctagccttgcccatgactggaaagtggccggg
ggcgaggatgccgcactggcgctgttcagtctggaaaaggcggcctatgaaattatctat
gaagcggcaaatcggcctgcctggttgcgggttcccttgcagggattaagcgatttgctc
acccacttgccaagtacggccaagcctttaccggatggagagaagtga

DBGET integrated database retrieval system