KEGG   Photobacterium gaetbulicola: H744_1c1488Help
Entry
H744_1c1488       CDS       T03698                                 

Definition
(GenBank) acyltransferase family protein
Organism
pgb  Photobacterium gaetbulicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1699185..1702073
Genome map
AA seq 962 aa AA seqDB search
MENPTKPPYSDPKQAAHSLLKLVTELAEEVNPGNVDSGTITLDSLLDQDLGLDSLARAEL
IQRTEQQFTITLPTQTLAEIETPRDLLNAIFNAEQHPAAIKASADKIELPSASIYPDHVE
TLQELLHWHVEQHGDRPHLYVYQDADNVESISYRTLYQQAIVIADRLQSLGIGPGDTVAI
MLPTCNAYFYCFYGILLSRAIPVPIYPPARPSQIEDHLVRHSKILQNAETKLLITVEQAK
GLSTLLKLHVPALEHIVTTEEIESLSVEPCSSEHQPIGHAQPDEIAFLQYTSGSTGVPKG
VKLTHANLLANVRAMGKAVGATSDDVFVSWLPVYHDMGLIGAWFGSLYHAIPLVIMSPLN
FLTQPKRWLWALHHHRGTLTAAPNFAYELCVNKITDADLEGLDLSSVRHCWNGAEPISPT
TIDAFSSRFQQYGFAPEAMNPVYGLAESSVGLTFPLSTRKPRVEWVDRQTMMNSGKAVNI
ETDPIEPGQQDNINARLEHSIPLIGLGHPLPGHQIRIVDSQGRELPERQEGELEFKGPSS
TSGYYHSPDKTTELYHGDWLRTGDRGLTMEGELFLTGRVKDIIIKAGRNIYPQELESAVS
QLNGIRKGCVAVFASANPQTGTEQLVVLAETKLEDEQEKHKLRDEIQSLSFNLLGIPTDV
VALCPPHTVPKTSSGKIRRSACKTLFEESKLDAPQRAVWWQATRLFLSSAKPALIRFRRL
ATDWGFACYMWLVMALLAPPVWILVAILPSTSACWSVARWGSRALIKLTGTKLTIYGLEH
LPDDDRPYLVIANHASYLDGLVLLAATGKEHQFVAKSELKDNFFAHTFLGKLGTHFVERF
DTQQSISDSQQLTSFADSPRPLTLFPEGTLYRMAGLHDFHLGAFQIAIDKQLPVQPITLK
GTRSILRDRSLFPRKGNIEVIISPQIHPEGNDWQATLALRNSARKVILENSGEPDLARET
TK
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacccaaccaaaccaccctattccgatcccaaacaggctgcccattcattactc
aagctggttaccgagctggcagaggaagtcaatcccggcaatgtcgatagcggtaccatc
acccttgatagcctgctcgaccaagatctcggcctcgacagcctcgcccgtgctgagctg
atccaacgcaccgagcagcaatttaccatcacgctaccgacacagacactggccgaaatc
gaaacaccgcgcgacttactcaatgccatcttcaatgccgagcaacacccagcggccatc
aaggcctcggcggataaaattgagttgccttctgcctctatctatcccgatcacgttgaa
acattgcaagaattgttgcactggcacgtcgagcagcatggcgatcgcccccacctgtat
gtgtatcaagatgccgacaatgtcgagtccatcagttaccggaccctctaccagcaagca
atagtcatcgccgaccggttgcaaagtctcggcatcggtcccggagatacggtggccatc
atgctgcctacctgcaatgcctatttctattgtttctacggcattttattatcgcgggct
atcccggtgccgatttacccaccagcaagaccatcgcaaattgaagaccacttggtcaga
cacagcaagatactgcaaaatgccgagaccaaattgctgatcaccgttgaacaagccaaa
ggactatcgaccctgctcaaacttcatgtgccggcattggagcatattgtcacgacagaa
gagatcgaatccctcagcgtagagccctgctcttccgagcaccagccgataggccatgcc
cagcccgacgagatagccttcctacaatatacatctggcagtaccggcgtgcccaaaggg
gtaaaacttacccatgccaacttgcttgccaatgtccgggccatgggcaaagccgtcggc
gccacttccgacgatgtctttgtcagttggttaccggtctaccacgatatgggcctaata
ggggcctggtttggtagtctttatcatgcgatcccactggtgattatgtcgccgcttaac
ttcctgacccagcccaaacgctggctgtgggcgcttcaccaccaccggggcaccttaacc
gccgcccccaactttgcctatgagttatgtgtcaacaaaatcaccgatgccgatctagaa
gggctcgatctctcttcggtaaggcattgctggaacggtgccgagcccatcagtccgaca
acaatcgatgctttcagcagccgctttcaacaatatggtttcgccccggaagccatgaac
cccgtgtatgggctggcagaatcctctgtcggattgaccttccccctaagtacccgcaaa
ccccgggtggaatgggtcgaccggcaaaccatgatgaactccggaaaagccgtcaatatc
gaaacagatcccattgagcctgggcaacaagacaatatcaacgcgcggctcgaacacagc
attcccctgatcgggctgggccaccccttacccggccaccagatccgcatcgtcgatagc
cagggaagggaattgcccgagcgccaggaaggcgaattggaatttaaaggcccctcatca
acatcgggctattatcactccccagacaaaaccaccgagctctaccacggcgactggctg
agaaccggtgatcgcggcctgaccatggaaggcgaactgttcctcaccgggcgggtcaag
gacatcatcatcaaggcgggccgtaacatctatccacaggagcttgaatcggccgttagc
cagctgaacggcattcgcaaaggctgcgtcgccgtctttgccagcgctaacccgcaaaca
ggcactgaacagttggttgtgctggccgaaaccaaacttgaggatgagcaggaaaagcat
aaattacgcgatgagatacagagtctgtctttcaacctgctcgggatccccaccgatgtc
gttgcactctgccccccgcataccgtacccaaaacatccagcgggaaaatccgccgttcg
gcatgcaaaacgctgtttgaggaaagcaaactcgatgctccccagcgcgccgtatggtgg
caagcgacccgcttattcttgtccagcgccaagccggcattgatacgattcaggcgcctg
gcaacagactgggggttcgcctgctatatgtggctagtcatggccctgttggcccccccc
gtttggattctggttgctattttgccttcaacctcagcctgttggtcggttgcccgctgg
ggctcacgggcgttgatcaagcttaccggcaccaagctcaccatctacggccttgagcat
ctccccgacgatgacaggccgtatctggttatcgccaaccatgccagttacttagatggc
ctagtactactggctgcaaccggcaaagaacaccagtttgtcgccaagtccgagctcaaa
gacaacttttttgcccatactttcctcggcaaattaggtacccattttgttgaacgtttc
gatacccaacaaagcatttccgatagccagcagctaaccagctttgccgatagcccaagg
ccgctgacgctttttcccgagggcaccttatatcgcatggccggcctgcatgatttccat
ctaggcgcatttcaaatcgctatcgataagcagttgccagtccaacccatcaccctcaaa
ggcacccgatccattttacgggatcgctcgctctttccccgcaaagggaatattgaggtg
attatcagcccacagatccaccctgaagggaatgattggcaagccacgttggcgctgcgc
aattcggccaggaaagtcatattggaaaacagtggggagcctgatttggccagagagaca
acgaaataa

DBGET integrated database retrieval system