KEGG   Pseudomyrmex gracilis: 109852448Help
Entry
109852448         CDS       T05003                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pgc  Pseudomyrmex gracilis
Brite
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109852448
Peptidases [BR:pgc01002]
 Metallo Peptidases
  Family M2
   109852448
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109852448
CD molecules [BR:pgc04090]
 Proteins
  109852448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 644 aa AA seqDB search
MLRLFLVAAIVTLAVTEAAPTEDTTISSDDVQQATENLKNAEDILKRLDVLYAEWNNKQS
IAEWNYASNLTEENLAEKLNVSAEAARVIKQIAQEVNAFPWRDLPDEDVKRRFKKLSILG
AAALPEDSFKEFKTTISQMENIYSTAKICDYKNKTKCDLALEPEITEILMKSRDPKELKH
IWVEWRKASGEKMKSLYTKYVELANTAARLNNFTDYAAYWMKDYEADDFPEQIEALWQQL
RPLYLQLHAYVRRELRKKYGEDIVSKDGPIPAHLLGNTWAQSWANIADFTVPFPGKQLPD
VSNALVEQGYNATSMFRLAENFFKSINLSAMPDTFWERSILEKQKDVDMICHASAWDFYD
GKDFRIKQCTRVTMENLLTAHHEMGHIEYYLQYKNQPTVYKEGANPGFHEAVGDVISLSV
SIPSHLKKIGLLNDDSTDQEAILNHLYAKSLDKIAFLPFSYMMDRWRWNVFQGKVTPDNY
NCDWWSLAEEYQGIEPPVDRSEEDFDPGAKYHIIADVEYIRYYVSFVIQFQFHKALCTEA
KQYDPKNPNANPLHQCDIYENKDAGNLLKSMLELGFSKPWPDAMERIAGQRQMDSAGLLE
YFKPLTDWLTEENKRTNEYIGWKPSSRKCVQTRGELEDTTESSE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtctatttctggtagcagcaatcgtgactctggcggtcaccgaagctgcgccg
acagaagatacgacaatttcttccgatgatgtgcagcaagctaccgaaaatctgaagaat
gctgaagatattttgaaacgtctcgatgtgttgtatgcggaatggaataacaagcagagc
atcgctgagtggaattacgcgtcaaatctgacagaagagaacctggccgagaagctaaat
gtgtccgcggaggcggctcgcgttatcaaacagatcgctcaagaagtgaacgctttccca
tggagagatttgccggacgaggatgtcaagaggcggttcaagaagctcagtatactcggt
gctgcagcgcttcctgaagacagtttcaaagaattcaagacaacgatcagtcaaatggag
aacatctatagcaccgcgaagatctgcgactacaaaaataaaacaaagtgcgacctcgcg
ctcgagccggagataacggaaattctgatgaagagtcgcgatcctaaagagctgaaacat
atctgggtggagtggaggaaagcgtcgggtgaaaagatgaaatctctatatacaaagtat
gtcgagctggccaacactgcggcaagactcaataactttaccgactacgccgcgtattgg
atgaaggattacgaagccgacgatttccccgagcaaattgaggctctctggcaacaattg
agaccactgtatctgcaacttcacgcttacgtacgacgtgaacttaggaagaagtatggc
gaagacatcgtctccaaggacggaccaattccggcgcacttgttaggcaacacttgggct
cagtcctgggcgaatattgcggacttcaccgtaccgttcccgggcaagcagttgccggac
gttagcaatgctctggttgaacaaggttacaacgcgacgagtatgttccgtctcgccgag
aacttcttcaagtcgattaacttgtccgccatgccggacacgttctgggagaggtcgatc
ctcgagaagcagaaggacgtagatatgatttgccatgcaagcgcgtgggacttctacgac
ggcaaagacttcaggatcaagcagtgcacgcgcgtcaccatggagaacttgctgacggca
catcacgagatgggtcacatcgagtattacttgcaatacaagaaccagcccacggtttac
aaagaaggcgcgaatcctggctttcacgaggcggtcggtgatgtcatctctctcagcgta
tccattcccagtcatcttaagaagatcggtctgctgaacgacgactcgactgaccaggaa
gcgatcctaaatcatctctacgcgaagagtctcgataaaatcgctttcttaccgttcagt
tacatgatggaccgatggcgttggaatgtcttccagggaaaagtcacacctgacaattac
aactgcgactggtggtcgctcgcggaggagtatcaaggtatcgaacctccggtagacaga
tcggaagaagactttgatcctggtgcgaagtaccacataatcgcggacgttgagtatata
agatactacgtgagctttgtgatacaattccagttccacaaagctctgtgcaccgaagcg
aagcagtacgatccaaagaacccgaacgccaatcctctgcatcaatgcgacatttacgag
aacaaggacgcaggaaatctgcttaaatccatgcttgaattgggtttttcgaaaccgtgg
ccggacgcaatggaaagaattgcgggtcaaaggcaaatggactcggctggacttttggag
tactttaaacctctaaccgattggctgacagaagaaaacaagagaactaatgagtatatt
ggatggaaacccagttctagaaaatgtgtacagacaagaggagagcttgaagataccaca
gagtcttcggaataa

DBGET integrated database retrieval system