KEGG   Pseudomyrmex gracilis: 109855900Help
Entry
109855900         CDS       T05003                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
  KO
K02358  elongation factor Tu
Organism
pgc  Pseudomyrmex gracilis
Brite
Translation factors [BR:pgc03012]
 Eukaryotic Type
  Elongation factors
   109855900
 Prokaryotic Type
   109855900
Mitochondrial biogenesis [BR:pgc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    109855900
Exosome [BR:pgc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109855900
  Exosomal proteins of breast cancer cells
   109855900
  Exosomal proteins of colorectal cancer cells
   109855900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D2 GTP_EFTU_D3 MMR_HSR1 Closter_coat
Motif
Other DBs
NCBI-GeneID: 109855900
NCBI-ProteinID: XP_020286188
LinkDB All DBs
Position
Unknown
AA seq 475 aa AA seqDB search
MALISTRVICNSVLRHSLKRIILTRQLPKCQRRNQLGQLFLPTVTSQRFYAEKKVFTRDK
PHCNVGTIGHVDHGKTTLTAAITKVLSEKALAKAKQYSEIDNAPEEKARGITINVAHIEY
QTENRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGTMPQTREHLLLAKQIGIEH
LVIFINKVDAADTEMVELVEMEIRELLTEMGYDGDNIPVVKGSALCALEGKNPEIGAQAI
LKLLETVDQHIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGKLKKGQDCEFIGYN
KVYKSVITGIEMFHQILEEAHAGDQLGALVRGLKRDDIRRGMVMCKPGTMKAYDHVEAQV
YMLTPEEGGKKKPLASLTQLQMFSRTWDIAAQCTISGKDLAMPGEDSTLILKLIRPMVLE
KGQRFTLRDGAITLGTGVITTTLKSLTDNERALLLEGKKALMKKEKEKEKKKHKQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttatttccacgagagttatctgtaattccgtgctgagacacagcttaaaacgg
attattctcacacgacagttgccaaaatgtcaacgtcgcaatcaattgggtcagttgttt
cttcctactgtcacaagccagagattttatgcagaaaagaaagtatttactcgtgacaaa
ccacattgcaatgtaggtactattggtcatgtagatcacggcaaaacaacacttacagca
gctatcaccaaagtattgtctgagaaggcattggcaaaagcaaaacaatacagcgaaatt
gacaatgctcctgaagaaaaggctcgtggtattactatcaatgtcgcacacattgaatat
caaacagaaaatcgtcattatggacacaccgattgtccgggtcatgccgattacattaaa
aacatgatcacgggaacggcgcaaatggacggtgctatattggtcgttgctgctacagat
ggcacaatgccacaaactagagaacacttgctgcttgctaaacaaattggtattgagcat
cttgtcatattcatcaacaaggttgatgccgctgatacagaaatggtggagttagtggaa
atggaaatacgagagttgcttaccgaaatgggttacgacggcgacaatattccagtagta
aaaggtagcgcgctctgcgcacttgaaggaaagaatcccgaaataggcgcacaggctatt
ctaaaattgttggaaacggtggatcaacatattccaacacccgtgagggagctggataaa
ccatttttgctcccggtggaaaacgtatattctattcctggacgaggtaccgtggttacc
ggtagattggagcgtgggaaactgaagaagggacaggattgcgaattcatcggttacaac
aaagtttacaaaagtgtgattacgggcatcgagatgttccatcagatattagaagaggct
cacgccggagatcagttgggtgctctggtgagaggtttgaagagggacgacatcagaaga
ggcatggtgatgtgcaaacccggcactatgaaagcgtacgatcatgtagaagcacaggta
tacatgttgactccggaagaaggcggcaaaaagaagcctctcgcaagtttgacgcagtta
caaatgttttcgagaacgtgggatatcgcagcgcagtgtacaatatcagggaaagacttg
gcaatgccaggagaagacagcacattgatattaaaactgataagaccaatggtgttggag
aaaggtcaacgtttcacattacgagacggagcgataactctgggaaccggcgttatcacc
accactttgaaatcccttacagataacgaacgagcgttacttctcgaaggcaaaaaagcc
ttaatgaagaaagagaaagagaaggaaaagaaaaaacataaacagtaa

DBGET integrated database retrieval system