KEGG   Pseudomyrmex gracilis: 109858549Help
Entry
109858549         CDS       T05003                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
pgc  Pseudomyrmex gracilis
Pathway
pgc00480  Glutathione metabolism
pgc00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pgc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109858549
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    109858549
Enzymes [BR:pgc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     109858549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 109858549
NCBI-ProteinID: XP_020291516
LinkDB All DBs
Position
Unknown
AA seq 244 aa AA seqDB search
MSNTPHLSTGSVPPPLAPGKIRLYSMRFCPYAQRIHLVLDAKQIPYDAVNLNLQKKPEWF
VDKNPLQKVPCIELPGGEILYESLIIADYLDETYPKNKLYPNDPLKKAKDRLLIDRFNSV
ITPMYKGFYLTTFDQRSFQEALTGLDIFEQELKKRGTPFFGGSEPGMVDFMIWPWCERAD
VIRLIRGEDFVAPKQRFLCLFEWKIAMKDHPAVRGTYLETEVHAKYIKSYMTGIPNYDML
TTKR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacgccgcatttgagtactggatcggtgccgccgcctctcgcgcctggcaaa
atacgtttgtacagcatgagattctgcccttacgcgcagagaatacacctggtgctggac
gctaagcaaattccatatgacgcagtgaatttaaatctacagaaaaaaccggaatggttt
gtggacaaaaatcccttgcagaaggttccctgcatcgaactgccaggaggggaaatattg
tacgagagtttaattattgccgactatctggatgaaacttatccaaagaacaaactgtat
ccaaacgatcccttgaagaaagctaaagacagactcttgatcgacagatttaattcagtg
ataacgcctatgtacaagggattttatttgacaacttttgatcaacggtcgtttcaagag
gcattaactggtttagacattttcgagcaagagttgaagaagagaggaactcccttcttc
ggaggttctgagccaggtatggtggatttcatgatttggccgtggtgcgagagagcggat
gttatcaggctcatacgaggggaggactttgtggcacctaaacagcggttcctgtgtctg
tttgaatggaaaatcgctatgaaagaccatccggcggtgcgtggcacttacctggaaacc
gaagtacacgccaagtacataaagagttacatgacggggatacctaattacgacatgtta
accactaagagataa

DBGET integrated database retrieval system