KEGG   Pseudomyrmex gracilis: 109860485Help
Entry
109860485         CDS       T05003                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase-like
Organism
pgc  Pseudomyrmex gracilis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MVFDRSFSSDRSFAGHARFVLTRLKVSVLFTMDEPGINDTIELLERFLKILKEEQVFDQN
AHHPVVRFLHPSELHKEIPISLHEESASDEEIERAIRQTIRYSVKTSSPHFHNQLYAGID
KYGLIGSWLTDVLNTSIYTYEVAPVFTLMEMEIIRKSAELFGYPADNSDGILNPGGSLSN
MYGMVMARFRKTPNVKELGLRESPQLVCFTSEQGHYSIVKAAHWLGLGVNNVYKVQTDEY
GRMKPNDLRRLVKKSRDENKLPFFVNATCGSTVLGAIDPLEEIYAICQEEELWFHVDACL
GGSVIFSKKYQHRLLGIALSDSLAWNPHKMLGVPLQCSLFLVKHKAALDTVNSVKAKYLF
QQDKFYDVTWDVGDKSVQCGRKVDAMKFWLMWKARGTSGFEQSVEKAMYCAEYFLKRIKE
TPGFRPVLSEYECNNVCFWYIPPSMRGQEETPIWWRDISRVTTKIKESMVLDGSLMIGYT
PLPNLLVNFFRMVVSCEPPPTEASMDYVISQIERFGANL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtattcgatagatcgtttagtagcgatcggtcattcgctggacacgctcgctttgtt
ctgaccagactcaaagtcagtgtattgttcacaatggatgagccaggcattaacgacaca
atcgagttactagaaagattcttgaagattctcaaagaggaacaagtttttgatcaaaat
gcgcatcatcctgtcgtgcgatttcttcatccttcagaattacataaagaaattccaatt
tcgttgcacgaggaatcagcgagcgacgaggaaatcgagagagcaatacgacagaccata
agatactccgtgaaaacatcaagtccacattttcacaatcaactctacgctggcattgat
aaatacggtttaatcggttcctggctaacagacgtcttgaacaccagcatatatacttac
gaggttgctcccgtatttactctgatggagatggaaattatacgaaaatcggcggagctg
ttcggctatccggccgacaatagcgacggtattttgaatccgggcggtagtttgtccaac
atgtacgggatggtgatggctagattcaggaaaacaccgaatgtcaaggagctgggtttg
cgtgaatcacctcaattagtgtgtttcaccagcgagcaaggtcactactcaatcgtaaaa
gctgcccattggctcggcttgggcgttaacaacgtttacaaggtgcagacagacgagtac
ggtcgcatgaaaccgaatgatctgagacgactcgtgaaaaagtcgagagatgaaaataaa
ctaccgtttttcgtgaacgctacctgcggtagtacggtgctcggcgccatcgacccgttg
gaagaaatttacgcgatctgtcaagaagaagaactctggtttcacgtagacgcctgtctc
ggtggttccgtgatattttcgaaaaaatatcagcatcgattgctaggcattgcattatcg
gactcgctagcttggaatccacacaagatgctcggagtaccgttacaatgttctctgttt
cttgtcaaacacaaggccgcgttggacacggtaaactccgtgaaagctaagtatcttttc
cagcaggacaaattttacgacgtgacctgggacgtgggtgataaaagcgtacagtgcggt
aggaaggtagacgcaatgaaattttggttaatgtggaaagctcgcggcacgagcggcttc
gagcaatcggtggagaaggcaatgtattgcgccgaatactttctgaaacgaattaaagag
actcctggttttcgaccggttctgtctgaatacgagtgcaacaacgtttgtttttggtac
atacctccgagcatgcgtggacaggaagagactccgatctggtggcgcgatatatcgcgc
gtcaccaccaagataaaagagagcatggttttagatggatctcttatgatcggttataca
cctttgccgaatcttcttgtgaatttctttcgcatggttgtgagctgcgagccgccacct
acagaagcgtctatggattacgttatcagtcagatcgaaagattcggagccaatttgtag

DBGET integrated database retrieval system