KEGG   Pseudomyrmex gracilis: 109860719Help
Entry
109860719         CDS       T05003                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
pgc  Pseudomyrmex gracilis
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pgc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109860719
Enzymes [BR:pgc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109860719
Chromosome [BR:pgc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109860719
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1331 aa AA seqDB search
MELRLHSPAGAEPIVYQWPLTSGSGSDRHDGALDVIETMRWVCEDLPDLKLPLENNILCN
YDPRDYESMKSLCDRFNRAIDSLVQLEKGTSLPFQRLNKRPSRGLLRHILQQTYNQAVVE
PDKLNQYEPFSPEVYGETSYELVSQMIDQIEVTGEDVFVDLGSGVGQVVLQMAAATMCKI
CIGVERADVPSKYAQSMEINFRKWLNWYGKRCGEYRLVKGDFLADEHRESITGATIVFVN
NFAFGPTVDHQLKERFADLRDGARIVSSKSFCPLNFRITDRNLSDIGTIMHVSEMSPLKG
SVSWTCKPVSYYLHVIDRTKLERYFHRLKNNKQGGSDENSDSVISNTASNSSRVSNRSER
GDKAKRDLSRQLDSPNNSEQLGTNSDSDLDDNGSTKSRRQANKIRRKFNKKTNGIRAPAR
GRQRGRGVKKSKPKKAINISGLDLLHSQTLLSTSPQALGKKPPPPPGCVDQQLSSLSLSL
QSHSTSVHEELSIPPAPSATPYALQILLDLYRDQFMLMLESMRTPSYKISVNTDIAKERE
RNSRLQSRAAQLEKQIKVLIDDSVALLKARMTELGINATSPGDLLAKAKEIVLRHKQLQA
KASKLQAQVANIESEQSRLVALRHQELQEKYNGHANGMTNPPQSLTQDYILKEIFATMSQ
RKRLHSQVSKLEHELNVLERTSSEKQAAAIVQQQRDAIGNKISQNSHQQQQQQVSKAGTI
RKREGRLRSQDWPDVPDIGKIQENNPEILAQKILETGRQIEAGRIPSRPSVNGRTRLPQA
SLSFSTAPSSISSTLSQSVNKDASDRNQEPPRVANFEDRLKSIITSVLNEDQQNRNKQQQ
LQLQSQSQPEPERKQRAPPPLPPNVSTPDYTQVSPAKLALRRHLSQERLSSSHLTSSDRS
TIDTRQSSGHDNRLALNGSSGILGTRTIGDLVSGEIERTLEISNQSIINATVDMSTIMRP
EAAYSPISRPASAEGDAGLSTLAHVASYAPTSAACTTTSTTGSRSSVLFTPVTQSQRYTT
VQLPRADIKPYHESYFLDNPSQSLTQSHPSVLPSHSSQGTLNGELLPVEGLAASLHARIV
NIHNNNNNNNSSKIDAALSNNKRFHPYPRYATNSSSSNGNSNGNATSNGTAICQSQSLTS
IKTEVSSVSTSGAPLSPLVEPHSNTSTPLVDEPQMATQRHRNVIGDDDGEADWQDRISSG
FDRLVAFASTELDKRRRSTEGVNTSPDSGMGSDSMGTGPPMVVPSPDDALGPPRTPSPTS
PRPLNSNGNSICGSSVPLKYQRQLDSERHHFKKKFFHRDWSTTAGTSKFRPKGKDWDWNH
SGQWPSNDEQS
NT seq 3996 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcgattacactcgccagcaggagcagaacccattgtgtatcagtggccgctc
acctccggatcgggatcagatcgacacgatggagcattggatgttatcgaaactatgcga
tgggtttgcgaggatctgccagatttgaagttacctttagaaaataatattctttgtaat
tacgatccgagagattacgaaagtatgaaaagcttgtgcgacagattcaatagagccatc
gatagcttagtacaattggaaaaaggcactagtctgccatttcagagactaaacaagaga
cctagcagaggcttgcttcgtcatatacttcagcaaacatacaatcaagctgtggtcgaa
ccggacaagctaaatcagtacgagcctttttcgcctgaggtttacggcgaaacgagttac
gagcttgtgtctcaaatgatcgatcaaattgaggtgacgggcgaagatgtgttcgttgat
ctgggttccggagttggccaagttgttcttcagatggcggccgcgactatgtgtaaaata
tgtatcggtgtagaaagggccgacgtaccttcaaaatacgcccagagcatggaaataaac
tttcgaaaatggttaaattggtacgggaagagatgcggggaatatcgtcttgtaaaagga
gactttttagcggacgaacatcgcgaaagtattaccggggctacgatagtgttcgtgaac
aacttcgcgtttggtccaacagttgatcatcaattgaaggagcgtttcgctgatttgcgg
gatggcgcgcgcatagtatcgtcgaagtccttctgtccgttaaactttcgtataacagat
aggaacttgagcgatattggcacgataatgcacgtgtcggaaatgtcgccgttaaaaggt
tccgtctcttggacctgtaagcccgtgtcgtattatttgcacgtaattgatcgtactaag
ttagaacgttacttccaccgcttgaagaacaataaacaaggtggctctgatgaaaattct
gattctgtgataagtaacactgccagcaatagtagtagggtttctaatagaagcgagaga
ggtgacaaagccaagagagacctttcgaggcaattggacagtccgaataattcggagcag
ctggggactaacagcgattctgatctggacgacaacggtagcacgaaaagtcgtcgacag
gcgaacaaaatacggcggaaattcaataagaaaacgaacggtattagagctcccgccaga
ggtagacagagaggacgaggcgtcaagaagtccaagcccaagaaggcgatcaatatatcc
ggattggatctgctgcacagtcagactttgctcagcacgtcgcctcaagctctcggaaag
aaaccaccgcccccgcccggttgtgtagatcaacaattgtcttcgttgtcgctttctttg
caatcgcattccacttcggtgcacgaggaactcagtataccgcccgctccgtccgcgact
ccttacgctctacaaatacttttggacttgtacagggaccaattcatgcttatgttggag
tcaatgagaacgccttcttacaaaatatcggttaacacggatatcgcgaaggaaagggag
agaaactcgaggcttcagtcgagagcggcgcagttagagaaacaaatcaaagttctgata
gacgatagtgtggctctcttgaaggctagaatgactgaattaggtattaatgctacgtca
cccggggatctattggcgaaggccaaggaaatagttttaagacacaaacagctgcaagct
aaagcgagcaagttgcaagcgcaagtggcgaatatcgagagcgagcagagcaggctggtt
gcgcttagacatcaagaactgcaggagaagtacaacggtcacgcaaacggcatgacaaat
ccaccgcaatcgctcacgcaggattacatactgaaggaaatctttgcaaccatgtcgcaa
cgcaaacgattgcactcacaagtttcgaaactcgaacacgaattaaatgtactggaaaga
acgagtagcgagaagcaggcggccgcgatcgtccagcaacagagagacgcgataggaaat
aagatctcgcagaactcgcatcagcagcagcagcagcaggtcagcaaagccggaacgata
cgcaaaagggaaggccgtttgaggtcgcaggactggcccgatgttccggatataggaaag
atacaggaaaacaatccggagatactggcgcaaaagattctggagacgggaaggcaaata
gaagcgggtcgtattccgagtagaccgagcgtgaacggcagaactcgattgccacaggcg
tctctcagtttctctaccgcgccgtcttctatttcgtccaccctatcgcagtcggtcaat
aaggacgcgtcggatagaaatcaagaaccaccgagggtcgctaatttcgaggacagactg
aagagcatcatcacgagcgttttgaacgaggatcagcagaacagaaataagcagcaacag
ctacagttacagtcgcaaagtcagcccgagccggagagaaagcagcgcgcaccaccaccg
ttgccaccgaatgtatccactccggattacacacaagtttcacccgctaaactggcgctt
cgtcgtcatctctcgcaggaacgcctctcgtcgtcccacctaacgtcgtccgacaggtcg
acgatcgacacaagacaatcatcaggtcacgacaatcggctcgcgctgaatgggagtagc
ggaatactcggcaccaggacaatcggcgacctcgtcagcggagagatcgagagaacgttg
gagatttcgaatcagtcgataataaacgccaccgttgatatgagcacgatcatgagaccc
gaggccgcgtactcgcctatcagcaggccagcgagcgccgagggagatgccggcttgtcg
accttggcgcacgtggccagttacgcgcccacttcggcagcctgcaccacaacgtccact
actggttcaagatcatcggttctctttactccagtgacgcaatcgcagaggtacacgaca
gttcaattaccgcgagcggatatcaagccctaccacgagtcctattttttggataatcca
tctcagtcgctcacgcagtcccatccgtcggtgctgccgtcgcattcatctcagggcacg
ctaaacggagaactattgcccgtagaaggactcgcggcgtcgttacacgctcgaatagtg
aacattcataataataataataataataatagcagcaagatcgacgcggctctttccaac
aataaacggtttcatccgtatccgcgatacgcaacgaacagtagtagtagtaatggtaat
agtaacggcaacgcaacgtcgaacggtaccgcgatttgccagtcgcaatcgttgacgtcg
ataaaaacagaagtatcgtccgtgagcacaagcggagcgccgctgagtcctctcgtggaa
ccgcattctaacacgtcgacgccgctggtcgacgagccgcaaatggcgacccaaagacac
cgaaatgtcatcggtgatgacgatggggaagctgattggcaagaccgcattagttcagga
tttgatcgcttggtcgcgtttgcttccacagaactggacaaacgtagacgatcgacagaa
ggagtaaatacaagccccgacagtggaatgggctcagacagcatggggacaggaccaccg
atggtggtgccgtcgcccgacgacgcattgggaccgccgagaacaccctcgccgaccagt
ccccgtcccttgaactccaacggcaattccatatgcggctcgtccgtacctctgaaatat
cagcgacaactggattccgagcggcatcactttaagaaaaagttttttcatcgcgactgg
agcactaccgcgggcaccagcaaatttcgtcccaagggcaaagattgggactggaatcat
tccggacagtggccgtcgaatgacgaacagtcttaa

DBGET integrated database retrieval system