KEGG   Pseudomyrmex gracilis: 109863670Help
Entry
109863670         CDS       T05003                                 

Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pgc  Pseudomyrmex gracilis
Brite
Enzymes [BR:pgc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109863670
Chromosome [BR:pgc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109863670
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1093 aa AA seqDB search
MKVYVERADAFDRYTRAESSGMKIAREHYDRATTIVRRHHYYLHHGGGGHHDRHRGMLPD
VCRCSMCVPEMARDTPGSPMPRPRDLGAGGGTATATLTSGAYHAAATDPALHDHALQQRI
LELQQQHQLQQQILRQQYQAQERQLAEMHEQQLTRLRLWEQQKQLADEKREKERLEALRK
KDKHDHSANASTEVKQRLQSFLVNRQREAAAAANGAVPGTPGYRSWLQSQTESSNTTNAA
HPYRMPQLLQEKFGDDFPLRKTASEPNLKVKLKQRVERNMASRNSPLARRKDRLLSHLKR
KSLLANSGSNPESGPNSPPTVNNSQASPTAGSNTAIQEEGENPTYGGRLTSSSQQGSLSD
LSLFSSPSMPNISLGRPHVPSSSSGTKLAPVSEAEVRAAFTARLGMPLTGQMLHGTLPFY
PSLTVIEGEPTYIHKQIQQDLREQAPPPTAVGGNRQHPAAPVYHTASPITDTQVAHARLH
KAGHRPLGSRTQSAPLPLGHPMLQGGIIAPTHYEEYLAEKQLHDQQQVHNYLKQQIRQTV
LTRVGSRGQTNQLDEAPETEESEVIDLTGKKDHSEESDLTKQQRDREQFLQQQRDLMMRH
TLQTNESSIYAGSRTSQSARPLSRALSSPLVHLGPQGSSGEMFARGSPHRPTTGVAYDPL
MLKHACVCGDSVRSHPEHGGRLQSVWARLSETGLLQRCDRVRSRKATLEEIQTCHSEEHT
LLFGTNPLNRQKLDMSQLSERLKKDNIFFRLPCGGVGVDNDTTWNELNTAPAARMAAGCV
IDLAIKTATGDIKNGFAVVRPPGHHAEPNRAMGFCFFNSVAIAARLLQQRFDVRKILILD
WDVHHGNGTQQMFYDDPRVLYLSIHRHEDGNFFPGTGGPMECGEGEGAGYNVNVAWSGGL
NPPMGDAEYLAAFRTIVMPIAKEFDPDIVIVSAGFDAAVGHSAPLGGYNVNPACFGRMTQ
QLLNLADGKVVLALEGGYDLPAICDSAQECVRALLGDEPSPIPDEELTRIPCQNAIDTLQ
KTIAIQMLYWPCVKLAAHTVAMSAIEASQKEHDETETVSAMASLSMQQPTNLTTTPEHSR
EVSEEPMEQDETK
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttacgtggagcgcgcggacgcgttcgatcgatacacgcgcgcggaaagttca
ggcatgaagatcgctcgcgagcattacgatcgcgcgacaacgatcgtccgccgccaccat
tactacctgcatcacggtggcggcggtcaccacgacagacatcgtggaatgttaccggac
gtgtgccgttgttccatgtgcgttccagaaatggccagggacacgccgggctcgccgatg
ccgcgaccacgggatctgggcgccggaggcggcacggccacagccaccctgacttccggc
gcttatcacgccgcagccaccgatcccgctctgcacgatcacgcgctgcagcagaggata
ctcgagctacagcagcagcatcaacttcaacagcagatcctgcgccagcagtatcaggct
caggaacgtcaactggccgagatgcacgagcaacagttgactcgactaaggctctgggaa
caacagaagcaacttgctgacgagaaacgggagaaggagagactcgaggctctcaggaag
aaggacaaacacgatcacagcgcgaacgcgtccacggaagtcaagcaacgtcttcagagc
ttcctggtgaacaggcagagagaagcagctgccgcggcgaacggagcggtacctggtaca
cccggatatagaagctggctacagtcgcagacagaatcgtcgaacactacgaacgcggcg
cacccctaccgaatgccgcagttgctgcaggaaaagtttggtgacgactttccgctcaga
aaaacagcctcggagccgaacctgaaggtgaaactaaaacagcgcgtggagaggaacatg
gcgtcgagaaactcacccctggcacgtcggaaggatcgcctgctgtcgcacctcaagcgg
aagtcgttactagcaaactctggcagcaatcccgaatccgggcctaattctcccccgact
gtgaacaattcgcaagccagtcccaccgccggaagcaacacggcgatacaggaagaaggt
gagaatcctacgtacggaggacgtctcaccagtagtagtcaacagggcagtctttcggat
ctttcgctcttcagttcaccgtccatgcccaacatctcgttgggcagacctcacgtaccg
tcaagctcaagcggaacgaaattagcgccggtttccgaggcggaagttcgcgccgcgttt
acagcgcgtctcggcatgccgctcactggtcagatgctgcacgggactttgccgttctat
ccatccctgacggtcatcgagggcgaaccgacgtacatccacaagcagatacagcaggac
ttgcgggagcaggcgccgccgcccacagcggtaggcggcaacagacaacatccggccgct
ccggtgtaccacaccgcgtccccgattacagatacacaagtagcgcacgcgagactgcat
aaggctggtcaccggcctttaggtagtagaacccaatccgcgccactgccgctaggtcac
ccgatgctgcaaggcggcataattgcgcccactcattatgaggaatatctcgcggagaaa
cagctgcacgatcagcaacaggtgcataactatctgaaacagcaaattcgtcagacggtg
ctgacgcgagtgggttcgcgcggccaaaccaatcaactggacgaggcaccggagaccgag
gaatccgaagtgatagatctcacgggcaagaaggatcattcggaggagagcgatctcacg
aagcagcaaagggatcgggaacagttcctgcagcagcagagggatctcatgatgagacac
acgttgcagacgaacgagtcgtccatctacgctggaagtagaacttctcagtctgccaga
ccgctctcgagagcgctgtcgagtccgctagtacacttaggtccacagggcagtagtggc
gaaatgtttgcacgagggtctccccaccgacctactactggagtagcctacgatccgctg
atgttgaagcacgcgtgtgtctgtggtgattcggtcaggagtcatcccgagcacggtggt
cgattgcagagtgtgtgggccaggttatccgagacgggtctgttgcagcgttgtgaccga
gtgcgctcgcgcaaggccacgctcgaagagatccaaacgtgtcacagcgaggagcatacg
cttctatttggaacgaatccgttgaatcgacagaaactggatatgtcgcagttgtctgaa
agactcaagaaagacaacatctttttccgccttccctgcggtggagttggcgttgataac
gacacgacatggaatgaactgaacaccgcgcccgccgcacgaatggcggcgggatgcgtc
atcgatcttgcgatcaagacggcaacgggcgatattaagaacggcttcgccgtggtgaga
ccgcccggacatcacgctgaaccaaacagggccatgggcttctgcttcttcaactccgtg
gcaattgcggcaaggctacttcaacaaagatttgacgttagaaaaattttaattttagat
tgggatgttcatcatggaaatggcactcagcaaatgttttacgacgatccgcgggtgttg
tatctgtcgatacacagacacgaggatggtaatttctttcccgggacaggcgggccgatg
gagtgcggcgaaggcgagggtgctggttataacgtgaatgtagcgtggtccggcggtctg
aacccacctatgggcgacgcggagtatctcgcggctttccgtacgatagtcatgccaatt
gctaaggagttcgatccggatatcgtgatcgtttccgctggtttcgacgctgcggtaggt
cattcggcaccgctgggtggctacaacgtcaatccggcctgcttcggcagaatgacacag
cagttacttaatctggccgacggaaaagttgttctcgctttggagggaggttacgattta
ccggcaatctgcgactcggcgcaagagtgcgttcgcgcgttgctaggtgacgagcccagc
ccgattccagatgaggaactgacgaggattccatgccaaaacgccatcgacacgttacag
aagactatagctattcagatgttatattggccctgcgttaaactcgctgctcatacggtc
gcgatgagcgcgatagaagcgagtcaaaaagaacacgacgagacggaaacagtgtccgca
atggcctctctgtctatgcagcagcctacaaacctcacaaccacaccagaacattcccga
gaggtttccgaggagccgatggaacaggatgagaccaaatga

DBGET integrated database retrieval system