KEGG   Pluralibacter gergoviae: LG71_03150Help
Entry
LG71_03150        CDS       T03300                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
pge  Pluralibacter gergoviae
Brite
Enzymes [BR:pge01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     LG71_03150
Lipid biosynthesis proteins [BR:pge01004]
 Acyl-CoA synthetase
  Unknown
   LG71_03150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
660131..661900
Genome map
AA seq 589 aa AA seqDB search
MAALHMSETSSTQSIPMRYADFPSLVEALDYAAQGNTGMNFYDRRNQLVAVLEYSDLKRR
AMANARRLLSLNLRKGDRVALIAETSVGFVESFFACQYAGLIAVPLAIPMGVGQRDSYMS
KLQGLIASCKPAAIISSEEWLPLINSVSTDTPDLRILSHADLNALPEADIELTLPAPEDI
AYLQYTSGSTRFPRGVIITHRSVMANLQVISHDGIKLRPGDRCVSWLPFYHDMGLVGFLL
TPVATQLSVDYMSTQDFAMRPMLWLKLISKNRGTVSVAPPFGYDLSLRRSTEKDMAELDL
SSWRVAGVGAEPISAEQLEQFGERFAAVGFNSNAFMPCYGLAENALAVSFSDENEGFKVN
EVDRDILEYQGKAVVPTKDTRAVSSFVNCGKALPGHRIEVRSESGIPLPEREVGRIFISG
PSLMSGYFHDAASQKEIKKTGWMDTGDLGYLLDGYLYVTGRKKDLIIIRGRNIWPQDIEY
VAEMEPEIHPGDAIAFVTPQDQEESGRIVLQIQCRVSSEERRAQIVHSLTARIQSEFSVA
VDIELLPPHSIPRTSSGKPARAEAKKRYLTALTEALTPPQMQQVAGYAQ
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttgcatatgtctgaaacaagttcaacccaatctatccccatgcgatatgct
gactttccatccctggtagaggctttagactatgccgctcagggaaatacagggatgaat
ttctacgaccggcgtaatcaactcgtagccgtactggaatatagcgatctgaagcgtcgc
gcgatggccaatgcccgtcgcctgctgtcgctcaatctgcgcaaaggcgatcgcgttgcc
ctcatcgctgaaaccagcgttggcttcgttgaatcattctttgcctgccagtatgccggt
ttaatcgccgtgccgcttgcgatcccaatgggtgttggccagcgtgattcatacatgagc
aaattacagggccttatcgccagctgtaagcccgcggcgattatcagtagcgaagagtgg
ctgccgctgatcaactctgtaagcaccgatacgccagacctgcgtattctcagccatgcc
gatttaaatgctctgcctgaagccgatattgaactgacgctgcccgcgcccgaagatatt
gcctatctgcaatacacctccggcagcacgcgcttcccgcgcggcgtcatcattacgcat
cgctccgtgatggctaacctgcaggttatcagccatgacgggatcaaattacgcccgggc
gatcgctgcgtctcctggctgccgttttatcacgatatgggcctggtgggcttcctgctg
acgccggtcgctacccagctttccgtggactacatgagcacccaggacttcgccatgcgc
ccgatgctgtggctgaagctcatcagcaaaaaccgcggcaccgtctctgttgcgccgccg
tttggctacgatctcagcctgcgccgcagcacagagaaagatatggccgagctggatctc
tccagctggcgcgttgccggggttggcgcagaacctatctccgccgagcagctggaacag
ttcggcgagcgctttgccgccgtgggcttcaacagcaacgcctttatgccgtgctatggc
ctggctgagaatgcgctggccgtcagcttctctgatgagaacgaaggtttcaaagtcaac
gaagtggaccgcgacatccttgaataccagggcaaagccgtggtaccgacaaaagacact
cgcgctgtttccagcttcgtcaactgcggcaaggccctgcctggccaccgtatcgaagtg
cgtagcgaaagcggcattccgctgccggagcgcgaagttggccgcattttcatctccggc
ccgagcctgatgagcggctacttccacgacgccgcatcgcagaaagagatcaagaaaacc
ggctggatggataccggcgacctcggctacctgcttgatggttacctgtacgtcactggc
cgtaagaaagacctgatcatcattcgcggccgcaacatctggccgcaggatatcgagtac
gtcgcggagatggagccagaaattcatcctggtgacgccattgcgttcgtcactccgcag
gatcaggaagagagcggtcgtatcgtgctgcagatccagtgccgcgtcagctccgaagag
cgccgcgcgcagatcgtccactccctcaccgcgcgcatccagagcgaattcagcgtcgcc
gttgatatcgagctgctgccgccgcacagtatcccgcgcacctcctccggcaagccggcg
cgtgcggaagcgaaaaaacgctacctgactgccctgactgaagccctgactcctccgcaa
atgcagcaagtggcaggctatgctcaatga

DBGET integrated database retrieval system