KEGG   Pluralibacter gergoviae: LG71_04615Help
Entry
LG71_04615        CDS       T03300                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pge  Pluralibacter gergoviae
Brite
Enzymes [BR:pge01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LG71_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
967417..968037
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALENLPEFANLPVEELITK
LDQVPADKKTALRNNGGGHANHSMFWKGLKKGTTLQGDLKAAIESTFGSVDKFKEEFEKA
AASRFGSGWAWLVLKDGKLAVVSTANQDSPLMGEAISGTSGYPILGLDVWEHAYYLKFQN
RRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtacgcgtatgatgcccttgagccgcactttgac
aagcagacgatggaaatccatcacaccaaacaccaccagacctacgtcaacaacgctaac
gcagcgctggaaaacctgccggagttcgctaatctgcccgttgaagagctgattaccaaa
ctggatcaggtgcctgctgacaagaaaactgccctgcgcaacaacggcggcggtcatgct
aaccacagcatgttctggaaaggtctgaaaaaaggcaccaccctgcagggcgacctgaaa
gcggccatcgaaagcactttcggctccgttgacaaattcaaagaggagtttgagaaagcc
gctgcctcccgctttggctccggctgggcgtggctggtgctgaaagacggcaaactggcc
gtcgtttccaccgctaaccaggactccccgctgatgggtgaagcgatttccggcacctcc
ggctacccgattctgggcctggacgtgtgggagcacgcctactacctgaaattccagaac
cgccgcccggactacatcaaagagttctggaacgtggtcaactgggacgaagcagcagcg
cgtttcgccgctaaaaaataa

DBGET integrated database retrieval system