KEGG   Phaeobacter inhibens 2.10: PGA2_c29340Help
Entry
PGA2_c29340       CDS       T02193                                 

Gene name
tuf1
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pgl  Phaeobacter inhibens 2.10
Brite
Translation factors [BR:pgl03012]
 Eukaryotic Type
  Elongation factors
   PGA2_c29340 (tuf1)
 Prokaryotic Type
   PGA2_c29340 (tuf1)
Mitochondrial biogenesis [BR:pgl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PGA2_c29340 (tuf1)
Exosome [BR:pgl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGA2_c29340 (tuf1)
  Exosomal proteins of breast cancer cells
   PGA2_c29340 (tuf1)
  Exosomal proteins of colorectal cancer cells
   PGA2_c29340 (tuf1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AFO88905
UniProt: A9EHA0
LinkDB All DBs
Position
complement(3200599..3201774)
Genome map
AA seq 391 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITKYFGDFKAYDQIDGAPEEKARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPKMVVFMNKVDQVDDEELLELVEMEIRELLSSYDYPGDDIPIVAGSALAAMEGNKPE
IGEEKIKELMAAVDDYIDTPERAVDQPFLMPIEDVFSISGRGTVVTGRVERGVINVGDSI
EIVGIRDTSTTTCTGVEMFRKLLDRGEAGDNIGALLRGVDRDGVERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVTLPEGTEMVMPGDNLKFDVEL
IAPIAMENGLRFAIREGGRTVGAGVVSKITD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgaacgtacaaaaccgcacgtcaacatcggcaccatcggccac
gttgaccacggcaagaccacgctgaccgcagcgatcaccaagtattttggtgacttcaaa
gcctacgaccagatcgatggcgcacctgaagagaaagcccgcgggatcaccatctcgacc
gcgcacgtggaatatgagaccgaagcccgtcactacgcccacgtcgactgcccgggccac
gctgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtgaacgctgctgacggcccgatgccgcagacccgcgagcacatcctgctgggccgccag
gttggcatcccgaagatggtcgtgttcatgaacaaagtggaccaggttgacgacgaagag
ctcctggagctggtcgaaatggaaatccgcgaactgctgtcgtcctacgactaccccggc
gacgatatcccgatcgttgcaggttcggctcttgcggcgatggaaggcaacaagcctgaa
atcggcgaagagaagatcaaggaactgatggcggctgttgacgattacatcgacacccct
gagcgcgctgttgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggt
cgtggtaccgttgtgaccggtcgtgttgagcgcggcgtgatcaacgttggcgactcgatc
gaaatcgttggtatccgtgacacctccaccaccacctgtaccggtgtggaaatgttccgc
aagctgctggatcgtggtgaagctggcgacaacatcggcgcgctgctgcgcggtgtggac
cgtgacggtgttgagcgtggtcaggttctgtgtaagccgggttccgtgaagccgcacacc
aagttcgaagctgaggcctatatcctcaccaaagaagaaggtggtcgtcacaccccgttc
ttcgcgaactaccgtccgcagttctacttccgcaccaccgacgtcactggcaccgtgacc
ctgcctgagggcaccgagatggttatgccgggcgacaacctgaagttcgacgttgaactg
atcgcgccgatcgcgatggaaaacggcctgcgtttcgccatccgcgaaggcggccgcacc
gtcggcgccggcgttgtgtcgaaaatcaccgactaa

DBGET integrated database retrieval system