KEGG   Phaeobacter inhibens 2.10: PGA2_c31690Help
Entry
PGA2_c31690       CDS       T02193                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pgl  Phaeobacter inhibens 2.10
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PGA2_c31690
Enzymes [BR:pgl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PGA2_c31690
Transporters [BR:pgl02000]
 Other Transporters
  Pores ion channels [TC:1]
   PGA2_c31690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3442227..3442817
Genome map
AA seq 196 aa AA seqDB search
MYTVIGKQLTRSYRVLWALEELGQPYELNPALPQSEDVVALNASGKVPVFKDGEDVITDS
TAIITYLADKHGKLTAPAGTLARAKQDAMTNRLLDELDAVLWTGARHSFILPEDKRVPEV
KDSLKWEFSRNLAQLEPCMTGPFLMGEELTIPDIICTHCLNWAYSAKFPIESDVLLAYSK
RMRARPAFQAVAASIT
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacaccgttatcggcaagcagctgacgcgcagctaccgcgttctttgggcgcttgag
gagctgggccaaccctatgagctgaaccccgccctgccacagagcgaagatgtcgtcgcc
ctcaacgcttcagggaaggtgccagtgttcaaagatggtgaggatgtgatcaccgattcg
accgccatcatcacctatcttgctgataaacacggcaagctgaccgcccccgcaggcaca
ctcgcccgggccaaacaggacgcgatgacgaatcgtctgctggatgagctggacgcggtt
ttgtggaccggcgcgcgccacagtttcatcctgcccgaggataagcgtgtgcctgaggtg
aaagacagcctgaagtgggagttttcccgcaatctggcgcagctggaaccctgcatgacc
ggcccgtttctgatgggggaagagctcaccattcccgacatcatctgcacccattgcctg
aactgggcctatagcgccaagttcccgatcgagagcgacgtccttctggcctatagcaag
cgcatgcgcgcacgtcccgcgtttcaggcggtagcagcgtcgatcacgtag

DBGET integrated database retrieval system