KEGG   Paenibacillus graminis: PGRAT_16550Help
Entry
PGRAT_16550       CDS       T03325                                 

Definition
(GenBank) peptidase M4
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
pgm  Paenibacillus graminis
Brite
Enzymes [BR:pgm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PGRAT_16550
Peptidases [BR:pgm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PGRAT_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3784711..3786315
Genome map
AA seq 534 aa AA seqDB search
MKKSLVSLLSGIVALGSFASVGIAAESTERSQPAELFTGSSPISITGQSSKAPAGDGSED
QVYNYLESVKGNLHLSSKDNIRGRFQIKEQQTNSKTGSQHYRISQYINGIPVYGADQTIH
IDKSGNVTSLLGTVVEDVYQSIPQPLIQLKTISGAEAVSAAETDAAQQYGPLGEAQVAPQ
ADLYYFIVAGEPKLAYKTEVNVLEPEPLRIRYFISAEDGSVLFKYNILENLTGTGTGVNG
DTKTFETRLSGSTYQLYDNTRGKGIVTYTAKNRTSLPGTLLTSSKNVWSDRAGVDAHTYA
ERTYDYYLQHFGRNSLDNKGLQIRSTVHYYTSYNNAFWNGSQIVFGDGDGTVFTLLSGDL
DVVGHELTHGVTENTANLEYYGEPGALNESFSDIIGNSIEGDNWLVGDDVYTPGVPGDAL
RSLANPTLYGQPDKYSDRYTGSDDNGGVHTNSGINNKAFYLVAQGGTFNGVTVAGIGRED
AVQIYYNALVYYLTTSSDFSAARTAVIQSATELFGAGSAQVTAVTQAYNAVGVY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttagtttcccttctttctggcattgtagcgttaggttcgtttgcatcc
gttggtatcgcagccgagagcactgagcgcagccaacccgcagagcttttcacgggttct
tcccctatttcaattacgggccagtcgtcgaaagccccagcgggagatggttcagaggac
caggtatataattatctggaaagcgtcaaaggcaacctgcatctgtcctccaaggacaat
atccgtgggagattccaaattaaggagcagcagacaaacagcaaaacaggcagccagcac
taccggataagccaatatattaacggaataccggtgtacggagcggaccagacaattcat
atcgacaaaagcggcaatgtcacttcactgcttggcactgtagttgaagatgtatatcag
tccatcccgcagccgcttattcagctcaaaaccatctcaggcgccgaagccgtctctgct
gccgaaacggatgccgcacagcagtatggtcctcttggcgaagcgcaagttgcgcctcaa
gcggatttgtattattttatcgtggccggtgagccgaagctggcttacaagacagaagta
aatgtactcgaacctgagccgctgcggatccggtactttatctctgcagaagacggaagc
gtgctgttcaaatacaatattctagaaaatctgaccggtacgggtacgggggttaacggc
gatacaaagactttcgagacgcggctttccggctcaacctatcagctgtatgacaacaca
cggggtaagggcattgttacttacacggccaagaaccgaacctctcttcccggaactttg
ctgaccagttctaaaaatgtctggtcggatagagctggtgtggatgcccatacttatgcg
gaaagaacctacgattattatctccagcactttggacgcaacagcctagacaacaaaggg
ctgcagattcgatccactgttcactattacacttcctataacaacgctttttggaatggt
tcgcagatcgtctttggggatggggacgggactgtatttactcttttatccggggacttg
gatgttgtgggacatgagcttacacatggcgtaaccgagaacacagccaatcttgaatac
tatggcgagccgggagctctgaatgaatccttctccgacatcataggaaactcaattgaa
ggggacaactggctggtaggtgatgatgtctatacacctggtgtaccaggtgacgcactg
cgttcactggccaatccaacgctctacggacagcctgataaatacagcgaccggtatacc
ggttccgatgataacggcggtgtgcatacgaacagcggcatcaataacaaggccttttat
ctggttgcccagggtggtacgttcaacggagtgacagtagcgggaattggccgcgaggac
gctgttcagatctattacaatgcactggtctattatcttaccacctcttctgacttctcc
gctgcccgcacagcagttatccaatctgcaactgagctgtttggagcaggctcggctcag
gttacggctgtgactcaagcgtataatgcggttggggtgtattaa

DBGET integrated database retrieval system