KEGG   Puccinia graminis: PGTG_02339Help
Entry
PGTG_02339        CDS       T02226                                 

Definition
(RefSeq) histone deacetylase 1/2
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
pgr  Puccinia graminis
Brite
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PGTG_02339
Chromosome [BR:pgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     PGTG_02339
   HDAC complexes
    Sin3A-HDAC complex
     PGTG_02339
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PGTG_02339
  Chromatin remodeling factors
   NuRD complex
    PGTG_02339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 632 aa AA seqDB search
MSGNMIPIAGEDKKRICYFFDSDIGNYHYGPGHPMKPHRIRMTHALVMNYGLYKKMEIFR
AKPATRKEMAQFHTDDYVDFLSKVTPDNMEEFAKEQAKFNLGDDCPVFDGLFEYCSISAG
GSMEGAARLSRDKCDIAVNWAGGLHHAKKAEANGFCYVNDIVLGILELLRYHKRVLYVDI
DVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGHGKGKHYAVNFPLRDGITDE
AYKNIFEPVIMKIMETYQPSAIVLQCGGDSLSGDRLGSFNVSMRGHANCVRFIKSLGLPL
LLLGGGGYTIRNVSRTWAYETGLAAGQELCTDIPMNEYYEYFGPTYRLDVPPSNMEDMNV
VKYLEKTKIQIFENLRHTIPVPSVGLQAIPRLAHDEMDVDEDLDDPNERRPQRLLDGLIQ
RDDEFSDSEDEGEGGRRDIQSHKRARRQSPKMNGNGILSIHSGIQNSFSQSRHSADLHFN
RPSSSHNSSLSVDTPDPPIVTPTPDPTIAAPTPDPPVTAPAPDPPITQPAPDLVVGPEPG
PSALRPTLDPPTVGPIANPHVVPLVPDPRVVTPVAAQPVVVPVEVPPVVVPVAATPIVAP
TPTTALVDIPMLSQVDQMELEKLTSEAFNAQI
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatatgataccgatcgctggcgaggataaaaaacgaatctgttatttcttc
gattcggacattggaaattatcattatggccctggtcaccccatgaaaccccatcgaatt
cgaatgacacacgctctggtgatgaactacggactatacaaaaaaatggagatctttagg
gcgaaacctgcaacccgcaaggagatggcacaatttcatacggatgattacgtggatttc
ctgagcaaagtgacccctgacaacatggaagaattcgcgaaggaacaagctaaattcaat
ttgggcgacgattgtcctgtatttgatggactgtttgaatattgctcgatatccgctggt
ggctcgatggagggagctgcgaggttatccagggataaatgtgatatagcggttaactgg
gcgggtggtctccatcacgcaaagaaagccgaagctaacggcttctgttatgtcaatgac
attgtattgggtatcctcgagcttcttcgctaccacaaacgcgtactctatgttgatata
gatgtgcatcatggtgacggagtggaagaggctttctacacgaccgaccgagtgatgaca
tgtagttttcataaatacggtgaattctttcctggtacaggtgaactacgtgatactggg
cacggaaaggggaagcactatgccgtcaattttcctctgagggatggtatcaccgatgag
gcgtacaaaaacatctttgaaccagtcattatgaaaatcatggagacatatcagccttca
gccatcgtgcttcaatgtggtggagattcattatcaggagaccgcttaggaagtttcaat
gtatcaatgcgaggacatgccaattgcgttcgattcattaaatctttgggactgccttta
cttcttctgggtggaggaggttacacaattcggaatgtatcaaggacgtgggcctacgaa
accggacttgcagcgggacaagagctgtgtacagatattccaatgaatgaatactatgaa
tactttggccccacttatcgcctagatgtaccaccctccaacatggaggacatgaacgtg
gtcaagtatttggaaaagactaagattcagatttttgaaaatttgcgacacacgattccc
gttccatcagttggcctgcaagctattcccaggctggctcacgatgagatggatgttgat
gaggatctggacgatcccaatgagcgtagacctcagcggctactggatggattgatacaa
cgagacgatgagttttctgatagtgaggacgagggcgaaggcgggcgacgtgatattcag
tctcacaaacgggcacggagacagtctcccaaaatgaatgggaatgggatccttagcatt
cactctggaatccaaaattcattttctcaatctcgacattcagctgacctccatttcaac
cggccgagctctagtcacaattcttctctatcggtagacacaccggaccctcctattgtc
acaccaacaccggatccaaccattgccgcgccaacaccggatccacctgttactgcgcca
gcgccagacccacctatcacccagccagcaccagacttagttgtcgggccagaaccgggc
ccctccgctctccggccaactctagacccacctactgtcgggccaatagccaacccacat
gttgttccactagtaccagatccacgtgttgtcacaccagtagcagctcaacctgtcgtc
gtgccagtagaagttccacctgtcgtcgtgccagtagcagctacacctattgttgcgcca
acaccaacaacagctttggttgatatcccaatgctctctcaagtcgaccaaatggagctt
gaaaaactgacttccgaagctttcaacgctcagatttga

DBGET integrated database retrieval system