KEGG   Puccinia graminis: PGTG_18479Help
Entry
PGTG_18479        CDS       T02226                                 

Definition
(RefSeq) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
pgr  Puccinia graminis
Brite
Translation factors [BR:pgr03012]
 Eukaryotic Type
  Elongation factors
   PGTG_18479
 Prokaryotic Type
   PGTG_18479
Mitochondrial biogenesis [BR:pgr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PGTG_18479
Exosome [BR:pgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGTG_18479
  Exosomal proteins of breast cancer cells
   PGTG_18479
  Exosomal proteins of colorectal cancer cells
   PGTG_18479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 10537758
NCBI-ProteinID: XP_003336683
UniProt: E3L6T9
LinkDB All DBs
AA seq 478 aa AA seqDB search
MSSICRNTILKGIANKPASRTSSLLSGSLSSRLGLQCRAVSSSTSSGLSCVQSRSRSSRN
PRSLLPIHSIASRSYAAEASKKFTRNKPHMNIGTIGHVDHGKTTLTAAITKSLAALNSNN
KFLDYSQIDKAPEEKARGITISTAHVEYETENRHYAHVDCPGHADYIKNMITGAAQMDGA
ILLVSATDGQMPQTREHLLLARQMGIQKLVVYVNKVDQIDDPEMLELVEMEMRDLLTSYG
FDGEQTPIVKGSALCALEGKSPEIGVESIKQLMKATDEWLDQPVRDLDKPFLMPVEDVFS
IPGRGTVVTGRVERGTVTKGTELELIGLGMNQKVALTGIEMFKKELERGEAGDNMGALLR
GLKREQIKRGMVLAAPGSMKAVTKFLASIYVLTKDEGGRYTPFMNNYRPQLFLRTSDVTV
SLTFPEEVKDRHEKQVFPGDNVEMICELVHQVAIEPGSRFTIREGGKTVGTGLVSRIF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaatctgtcgaaacacgatactcaaggggattgccaacaagcccgccagcagg
acatccagtctactttcaggctccctctcctctcgactcggtcttcaatgtcgggccgtc
tcctcttctaccagctccggtctatcgtgtgtccagtcaaggtctcgttcgtcgagaaac
cctagatcgcttctccctattcattccattgccagtcggtcatatgcggcagaagcctcg
aaaaaattcacgagaaacaagccacacatgaacatcgggacgatcggacatgtcgatcac
ggaaaaactacattgaccgccgcaatcacgaaatctctggcagccctcaactcaaacaac
aagttcctcgattattcgcaaatcgacaaggcgcccgaagaaaaagctagaggaatcact
atctctactgcccatgttgaatacgagaccgaaaaccgacattacgcccacgttgattgt
ccaggtcacgcggattacatcaagaacatgatcaccggtgcggctcagatggacggagca
attctattagtctcggcgaccgatggccagatgccacaaacgcgagaacatctcctgtta
gcgcgccagatggggatccagaagctggtggtatatgtgaacaaggttgaccaaatcgat
gatccggagatgttagagcttgtggagatggagatgcgggatctcttgacgagttacggg
ttcgatggcgagcagacgccgatcgtcaagggctcggcgctctgtgcactcgaagggaaa
agcccggagatcggggtggaaagcatcaagcaattgatgaaggccaccgatgaatggcta
gaccagcctgtgcgagacttggacaagcccttcctgatgccggtcgaggacgtgttttcg
atccccggacgagggaccgttgtgactggtcgagtggaacgaggaacagtgaccaaggga
accgaattagaattgatcggcctcgggatgaaccagaaggtagccttgaccggaatcgag
atgttcaagaaagagctcgagagaggcgaggcgggcgataacatgggcgcgctattacga
ggtctcaagcgagaacagatcaagcgagggatggtgcttgcagcgccaggttcgatgaaa
gcggtgaccaagttcctagcgagtatctatgtcttgacgaaggatgaggggggtcgttac
acacccttcatgaacaactatcgtccgcaattgttcctccgaaccagtgatgtgaccgtc
agcttgaccttccccgaagaggtcaaagaccggcacgaaaagcaagtcttcccgggcgac
aacgtcgaaatgatctgtgaattggtccatcaagtcgccatcgaacccggatctcgtttc
actatcagagagggcgggaaaactgtgggcactggcttggtctctcgaatcttctaa

DBGET integrated database retrieval system