KEGG   Meyerozyma guilliermondii: PGUG_04729Help
Entry
PGUG_04729        CDS       T01150                                 

Definition
(RefSeq) similar to translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pgu  Meyerozyma guilliermondii
Brite
Translation factors [BR:pgu03012]
 Eukaryotic Type
  Elongation factors
   PGUG_04729
 Prokaryotic Type
   PGUG_04729
Mitochondrial biogenesis [BR:pgu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PGUG_04729
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_04729
  Exosomal proteins of breast cancer cells
   PGUG_04729
  Exosomal proteins of colorectal cancer cells
   PGUG_04729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 426 aa AA seqDB search
MFKNLAGSFRAVSRVAFKTRPSLVRSYAAFDRSKPHVNIGTIGHVDHGKTTLTAAITKVL
SEKGGANFLDYGSIDRAPEERARGITISTAHVEYQTDKRHYAHVDCPGHADYIKNMITGA
AQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHLVVFVNKVDTIDDPEMLELVEMEMRE
LLSQYGFDGDNTPVIMGSALCALESKQPEIGVQAIEKLLDAVDEHIPTPTRDLEQPFLLP
VEDVFSISGRGTVVTGRVERGSLKKGEEIEIVGDFDKPFKTTVTGIEMFKKELDAAMAGD
NAGILLRGVKRDDVKRGMVLAKPSTVTSHKKVLASLYILSKEEGGRHSPFGENYKPQLFI
RTTDVTGTLRFPAGEGVDHSQMVMPGDNVEMEIELVRKTPLEVNQRFNIREGGKTVGTGL
VTRIIE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaacttggctggatcattccgcgctgtcagccgtgtcgctttcaaaacacgc
ccatcccttgttcgttcgtatgcagccttcgaccgttcgaagcctcatgtcaacattgga
accattggtcacgttgatcatggtaagaccactttgaccgctgctatcaccaaggttttg
tcggaaaaaggaggtgctaatttcttggattacggctccatcgacagagctccagaagag
agagccagaggtatcaccatttccactgcccatgttgagtaccaaactgataagagacat
tatgcccacgttgactgtccaggtcacgccgattacattaagaatatgattactggtgcc
gcccagatggacggtgccattattgttgttgctgccactgacggtcaaatgcctcagacc
agagagcacttgttgttggccagacaagttggtgtgcaacacttggtagtttttgtgaac
aaggtggacaccattgacgatcccgagatgttggaattggtcgagatggaaatgagagaa
ttgttgagtcagtacggtttcgatggtgacaacaccccagttatcatgggatctgctttg
tgtgctttggaaagtaagcagccagaaattggtgtgcaagccattgaaaaattgttggac
gctgtcgatgagcacattcctactcctacccgtgacttggaacagccattcttgttgcct
gttgaagatgtgttctccatttctggtagaggaactgtggttactggtagagtcgaaaga
ggttcgttgaagaagggtgaggaaatcgagattgttggtgactttgacaagccattcaag
accactgtgactggaattgaaatgttcaagaaggaattggatgctgctatggctggtgac
aatgctggtatcttgttgagaggtgtcaagagagacgatgtcaagagaggtatggttttg
gccaagccttccaccgtcacttctcacaagaaggtgttggcttccttgtacatcttgagt
aaggaagaaggtggccgtcactctccttttggtgagaactacaagcctcaattgttcatc
agaactactgacgttaccggtactttaagattcccagccggcgagggtgtcgaccactcg
caaatggttatgccaggtgacaatgttgagatggaaattgagcttgtgagaaagacacca
cttgaagtcaaccagcgtttcaacatcagagagggtggtaagactgtgggtactggtttg
gtgaccagaatcatcgagtaa

DBGET integrated database retrieval system