KEGG   Polymorphum gilvum: SL003B_2975Help
Entry
SL003B_2975       CDS       T01458                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pgv  Polymorphum gilvum
Brite
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SL003B_2975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3198970..3199569)
Genome map
AA seq 199 aa AA seqDB search
MSFQLPDLPYAYDALGPYMSAETLEYHHDKHHLAYVSNGNNLLKDSGLEGKSVEEVVKES
FGKNPGLFNNAGQHYNHIHFWKWMKPNGGGTKLPGALASKIDSDLGGYDKFRADFINAGI
TQFGSGWAWLALKDGKLAIMKTPNGENPLVHGAAPLLGVDVWEHSYYIDYRNLRPKYLEA
FVDNLVNWDYVLEMYEAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcaattgccggacctgccctacgcctatgacgcgctcggcccttacatgtcg
gcggaaacgctggagtatcaccacgacaagcatcacttggcctatgtcagcaacggcaat
aacctgctgaaggacagtggcctggagggcaagtcggtcgaggaggtggtcaaggagagc
ttcggcaagaacccgggtctcttcaacaatgccggtcagcactacaaccacatccatttc
tggaagtggatgaagccgaacggcggcggcaccaagcttccgggcgcgctcgcctcgaag
atcgacagcgatctcggcggctacgacaagttccgcgccgacttcatcaacgccggcatc
acgcagttcggctccggttgggcctggctggcgctcaaggacggcaagctggcgatcatg
aagaccccgaacggcgagaacccgctggtccatggcgccgcgccgctgctcggcgtcgac
gtgtgggagcactcctactacatcgactaccgcaacctgcggccgaagtacctggaagcc
ttcgtcgacaacctggtcaactgggactacgtcctggagatgtacgaagcggccgcgtga

DBGET integrated database retrieval system