KEGG   Pantholops hodgsonii (chiru): 102317706Help
Entry
102317706         CDS       T02909                                 

Definition
(RefSeq) glutathione S-transferase Z1-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-GeneID: 102317706
NCBI-ProteinID: XP_005963650
LinkDB All DBs
Position
Un
AA seq 218 aa AA seqDB search
MMVRPVRDGRTPAAGRARRPRQEEVDAFIVLEESGLPYTAHRVNFAEGEQRSETFLKINP
KGRVPALATASGVLTETPAILAFIAQMAPEKKLAPLDDPFEFAVMQSFNAYISSTVHVAH
AHGRRGSRWANEESSFADMKAKVPQTMGECFELIEHGLLHGPWVLGTAYSVADPYLFVMS
GWLESDGVDIARFPKVHDHFRRMNDRPAVQRALASERG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatggttcgccctgtgcgtgatggccgaaccccggccgccggcagggcccggcgtccg
cgacaggaagaggtggacgccttcattgtcctggaggaatcgggcctgccctacacggcc
caccgcgtcaatttcgccgagggcgaacagcgctccgagacatttctgaagatcaatccg
aaaggccgcgtaccggcgctcgccaccgcgagcggcgtgctgaccgagaccccggccatc
ctcgccttcatcgcccagatggccccggagaagaagctcgcgccgcttgacgatcccttc
gaattcgccgtcatgcaatccttcaacgcctatatttcttccaccgtgcatgtcgcccac
gcccatggccggcgcggcagccgctgggcgaacgaggagagttcgtttgcggatatgaag
gcaaaggtgccgcagaccatgggcgagtgtttcgaactgatcgagcacggcctcctgcac
ggcccgtgggttctgggcacggcctattcggtcgccgatccctatcttttcgtcatgtcc
ggctggctggaaagcgacggtgtggacattgcccgcttcccgaaggtgcatgaccacttc
cgccgcatgaacgaccgcccggcggtgcagcgggccttggcgagcgagaggggttaa

DBGET integrated database retrieval system