KEGG   Pantholops hodgsonii (chiru): 102321525Help
Entry
102321525         CDS       T02909                                 

Definition
(RefSeq) glutathione S-transferase F14-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 102321525
NCBI-ProteinID: XP_005957863
LinkDB All DBs
Position
Un
AA seq 209 aa AA seqDB search
MADPVLLYTNPMSRGQIARWMLEEVGAPYEAVILDYAGGMKTADYRAINPMGKVPAIVHG
GKVVTECAAICAYLADAFPAAGLAPATDDRADYYRWLFFAAGPVEAAVTNKAMGFILPEG
RERSAGYGSLDDTLDTLETAVTGRSWICGGTFTAADVYVGAQIDWGLTFGTIPSRPAFEA
YAARLRERPAYKRQKEIDNALIAEMQKQG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggttcttctctataccaaccccatgtcgcgcgggcagattgctcgatgg
atgctggaggaggtcggcgccccctatgaggcggtgatcctggattatgccggcggcatg
aagaccgccgactatcgcgcgatcaacccgatgggcaaggtgccggcgatcgtccatggc
ggcaaggtggtgaccgaatgcgccgccatctgcgcctatctggccgatgccttcccggct
gccggcttagcgccggcgaccgatgaccgggccgattattatcgctggctcttcttcgcc
gccggcccggtggaggccgccgtcaccaacaaggcgatgggcttcatcctgcccgaggga
cgcgaacgcagcgcgggctatggctcgctcgacgacacgctcgacacgctggaaacagcg
gtcaccggccgcagctggatctgcggcggcaccttcaccgcggcggacgtctatgtcggc
gcgcagatcgactgggggctcaccttcggcaccatccccagccgcccagcgttcgaggcc
tatgccgcccggctgcgcgaacgcccggcctataaaaggcagaaggagatcgacaacgcc
ctgatcgccgagatgcagaaacagggctga

DBGET integrated database retrieval system