KEGG   Pantholops hodgsonii (chiru): 102332777Help
Entry
102332777         CDS       T02909                                 

Gene name
TGM5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
phd  Pantholops hodgsonii (chiru)
Brite
Enzymes [BR:phd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102332777 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 717 aa AA seqDB search
MAEGLEVALTDLQSSWNNVRHHTDEISSNRLLVRRGQAFNITLYFRNRAFQPGLDNIIFV
TETGPLPDLPKGTRAVFSLAGHRGPSPWIASLQTIGASSLEVSLCAPPVAAVGRYLLKVH
IRSLQGPVTAYQLGEFILLFNPWCPEDAVYLESEPQRQEYVMNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDSGVLNG
NWGENYSDGTNPTEWMGSVAILKQWHATGCQPVRYGQCWVFAAVTCTVMRCLGIPTRVIT
NFNSGHDTDGNLIIDEYYDNTGRILENKKKDSVWNFHVWNECWMARNDLPPGFGGWQVLD
ATPQETSNGLYCCGPASIRAIKEGEVDLNYDTAFAFSMVNADCMAWLVFGGKEQKLHQDT
NTVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKAGRSPGSLRAESQPR
SVPLSDSPRSLATPSLQPSDVVQVSMKFQLLDSPDMGQDIRFVLLALNMSPQLKDLRVNL
SAQSLLHDGSPLLPFWQDTAFITLSPEEAKTYPCKITYSQYSQYLSTDKLIRISALGEEK
NSPEKILVNKIITLAYPSIVINVLGAAIVNQPLSIQVVFSNPLSEQVEDCVLTVEGSGLF
RRQQRVLIGVLKPHHRASLTLETIPFKSGQRQIQANLRSNKFKDIKGYRNVYINFGL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagggctggaggtggccctcaccgacctccagagctcctggaacaacgtgcgg
caccatacagacgagatcagctccaaccgcctccttgttcgccggggccaggccttcaac
atcaccctgtacttcaggaaccgggccttccagccaggcctggacaacatcatttttgtg
actgagactggaccgctgccagatctgcccaaggggactcgagcagtgttcagcctggca
ggtcaccgtggccccagcccctggattgcctcactgcagaccatcggggccagttccctg
gaggtgagcctgtgtgcccctcctgtggcagctgtgggtcggtacctcttgaaggttcac
atcagatccctacaggggcctgtcacagcctaccagcttggggagttcatcctgctcttc
aatccctggtgcccagaggatgctgtctacctggagagtgaaccccagaggcaggaatat
gtcatgaatgattatggcttcatctatcaagggaacaagaactggatccgcccctgcccc
tggaattatggacaatttgaagagaatatcatagacatctgtctggagctgctagacaaa
agcctgaacttccagattgacccagccacagactgtgccctacggggcagccctgtctac
atcagcagagtggtgtgtgccatgatcaacagcaacgatgacagtggggtgctcaatgga
aactggggcgagaattactcagatggcaccaaccccacggagtggatgggcagcgtggcc
atcctgaagcagtggcacgccacgggctgccagccagtgcgctacgggcagtgctgggtc
tttgctgctgtcacatgcacagtgatgaggtgcctggggatccccactcgagtgatcacc
aacttcaactctggccacgacacagatggaaacctgatcattgatgagtattatgacaac
acaggcaggattttggagaataagaagaaggacagtgtctggaatttccacgtctggaat
gaatgctggatggcacggaacgacctcccacctggattcggaggctggcaggtgctggac
gccacacctcaggagacaagcaacggcctctactgctgcggccccgcctccatcagagcc
atcaaggaaggagaggtggacctgaactacgacacagccttcgccttttccatggtgaat
gctgactgtatggcctggctggtctttggagggaaggagcagaaacttcaccaggacacc
aatactgttggcaattttattagcaccaagagcatccagagtgatgagcgggatgacatc
acggaaaactacaagtatgaagaaggttctctgcaggagaggcaggtgtttctgaaggct
cttcagaagctgaaggctggaaggtccccaggctccctccgagcagaatcgcaacctagg
tccgtgccactgagtgacagtccgcggagcctggctactccttctctccagcccagtgat
gttgtccaggtctccatgaaattccagctgctcgactcgcccgacatgggccaggacata
aggtttgtcctgctggccctcaacatgtcgccccagctcaaggacctcagagtgaacctg
agtgcccagtctctgctgcatgacggcagccccctgctcccattctggcaggacacagcc
ttcatcacactctctcctgaagaagcaaagacctatccctgcaaaatcacctattcccag
tacagccagtacctgtccacagacaagctgatccgcatcagtgccctgggtgaagagaag
aacagtcccgagaagatcctggtgaacaagatcatcaccttagcctatcccagcatcgtg
attaatgttttaggagcagccattgtgaaccagccgctctctatacaggtggtattttca
aatcccctctcggagcaggttgaagactgtgtgctgactgtggaaggaagtggtctcttc
agaagacagcagagagtcctcattggagtcctcaaaccccatcacagagccagtctcact
ctggagactatccccttcaagagtggccaaaggcaaatccaagcgaatctgaggagcaac
aaatttaaggacatcaagggttacaggaatgtctatataaactttgggttataa

DBGET integrated database retrieval system