KEGG   Pantholops hodgsonii (chiru): 102333854Help
Entry
102333854         CDS       T02909                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:phd00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102333854
   04614 Renin-angiotensin system
    102333854
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102333854
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102333854
Enzymes [BR:phd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102333854
Peptidases [BR:phd01002]
 Metallo Peptidases
  Family M2
   102333854
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102333854
CD molecules [BR:phd04090]
 Proteins
  102333854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1240 aa AA seqDB search
MASPVYPLMPSWCPQEEAALLSQEFSEAWGQKAKGLFDPVWQNFTDPTLLRIIGAVRTLG
PANLDLEKRQKYNSLLSNMSRIYSTAKVCFPNKTAPCWSLDPELTNVLASSRSYALLLYA
WEGWHNAAGIPLKPLYQDFTALSNEAYKQDGFSDTGAYWRSWYDSPTFMEDLERLYQQLE
PLYLNLHAYVRRALYRRYGDRYINLRGPIPAHLLGNMWAQSWENVYDTVVPFPDKPNLDV
TSAMVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGREVVCHASAWDFYN
RKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQHVSLRRGANPGFHEAIGDVLALSV
STPAHLHKIGLLDQVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRY
NYDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEA
GHQGPLHQCDIYQSTQAGAKLRALLQAGYSRPWQEVLKDMVGSDNLDAGPLLSYFQPVTQ
WLEEQNQQNGEVLGWPEYQWRPPMPDNYPEGIDLVSDEAEARKFVEEYDRRSQVVWNEYA
EANWNYNTNISTDNSKLLMEKNLQMANHTVKYGTWARKFDVTNFQNATMKRMIKKIQDLE
RAALPVKELEEYNQILVDMETVYSVASVCHKNGTCLRLEPDLTKLMATSRNYQDLAWAWK
SWRDKVGRSILPYFPKYVELTNKAARLNGYQDGGDSWRSMYEMPFLEEELEQLFQELQPL
YLNLHAYVRRALHHHYGPDVINLEGPIPAHLLGNMWAQSWSNIYDLVAPFPSAPKMDATE
AMIKQGWTPLRMFKEADNFFTSLGLLPMPPEFWNKSMLEKPTDGREVVCHASAWDFFNGK
DFRIKQCTSVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVST
PTHLHQIGLLSSGDGSYEEDINFLMKMALDKIAFIPFSFLVDQWRWRVFDGSVTRENYNQ
EWWSLRLKYQGVCPPLARSQDDFDPGAKFHIPASVPYVRYFVSFVIQFQFHQALCQAAGH
QGPLHKCDIYQSKEAGKLLADAMKLGFSQPWPEAMRLITGQSNMSAAAMMTYFKPLLDWL
VTENGRHGEKLGWPQYNWTPNSGTAPRPPGPQGSPGARSGLGPSQAKTPVSASLDDRGEA
VPTWGIAEEVVTTGRGAIPTFSASDLRAEPCPRLPVRDQL
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccctgtttacccactcatgccctcctggtgcccacaggaggaagcagccttg
ctcagccaggagttttcagaggcctggggccagaaggccaagggtctgtttgacccggtc
tggcagaactttaccgaccccacgctgctgcgcatcatcggggccgtgcgcaccctgggc
cccgccaacctggacctagagaagcggcagaagtacaactctctgctaagcaacatgagc
aggatttactccaccgccaaggtctgcttccccaacaagactgccccctgctggtccctg
gacccagagctcaccaacgtcctggcttcctcgcgaagctacgccctgctgctgtatgcc
tgggagggctggcacaacgctgcaggcatcccactgaagcccctataccaggacttcact
gccctcagcaacgaggcctacaagcaggatggcttctcagatacaggggcctactggcgc
tcctggtatgactctcccaccttcatggaggatctggaacgcctctaccagcagctggag
cccctctacctgaacctccatgcctacgtccggcgtgcactgtaccgccgatatggggac
agatacatcaacctcaggggacccatccccgctcacctgctggggaacatgtgggcccag
agctgggagaacgtctacgacacggtggtgcccttccctgacaagcccaatcttgatgtt
accagtgctatggtgcagaagggctggaacgccacacacatgttccgggtggcggaggag
ttcttcacctccctggggctcttgcccatgccacccgagttctgggcggaatccatgctg
gagaagccaagcgacgggcgggaggtggtgtgccacgcgtccgcctgggacttctacaac
aggaaagacttcaggatcaagcagtgcacacgggtcactatggaccagctgtccacggtg
caccacgagatgggccacgtgcagtactacctgcagtacaaggaccagcacgtctccctg
cgccgaggcgccaacccaggcttccacgaggccatcggcgacgtgctggccctctccgtc
tccactcctgcacacctgcacaagatcggcctgctggaccaggtcaccaacgacacagag
agcgacatcaactacttgttaaagatggcactggaaaaaattgccttcctgccctttggc
tacttggtggaccagtggcgttggggggtctttagtgggcgaacccccccttcccgctac
aactatgactggtggtatcttcgaaccaagtatcaggggatctgtcctccagttgtccga
aatgaaacccactttgacgctggagccaagtttcatgtcccaaatgtgaccccgtatatc
aggtacttcgtgagctttgtcctgcagttccagttccacgaagcgctgtgcaaggaggca
ggccaccaaggccccctgcaccagtgtgacatctaccagtccacccaggcgggggccaag
ctccgggcgctgctgcaggcaggctactcacggccctggcaggaggtgctgaaggacatg
gtcggctcagacaacctagacgctgggccgctgctcagctacttccagccggtcacacag
tggctcgaggagcagaaccagcagaacggcgaggtcctgggctggccagagtatcagtgg
cgccctccgatgcctgacaattacccggagggcattgacctggtgtccgacgaggccgag
gcccgcaagtttgtggaggaatatgaccggagatcccaggtggtgtggaacgagtatgct
gaggccaactggaactacaacaccaacatcagcacggacaacagcaagttgctgatggag
aagaacttacagatggcaaaccacaccgtcaagtatggcacctgggccaggaagttcgac
gtgaccaacttccagaatgccaccatgaagcggatgataaagaagattcaggatctagag
cgggcggcactgcccgtcaaggagctggaagagtacaaccagatcctggtggacatggag
accgtttatagcgtggcctctgtgtgccacaaaaatggcacctgcctgcggctcgagcct
gatctgaccaagctgatggccacatcccggaattatcaggacctggcctgggcgtggaag
agctggcgcgacaaggtggggcggtccatcctcccctacttccccaaatatgtggagctc
accaacaaggccgccaggctcaacggctaccaggatggcggggactcctggaggtccatg
tatgagatgcccttcctagaggaggagttggagcagctgttccaagagcttcagccgctc
tacctgaacctgcatgcctatgtgcgccgggccctgcaccaccactacgggcccgacgtc
atcaacctggagggccccatcccagcccacctgctcgggaacatgtgggcacagagctgg
tccaacatctatgacttggtggcacccttcccttcagcccccaagatggatgccacggag
gccatgataaagcagggctggacacccctaaggatgtttaaggaagcagacaatttcttt
acttccctggggctgctacccatgccccccgagttctggaacaagtcgatgctggagaag
ccgaccgatgggcgggaagtggtgtgccacgcctccgcctgggacttcttcaacggcaag
gactttaggatcaagcagtgcacctcagtgaacatggaagacctagtggtggcccaccac
gaaatgggccacatacagtacttcatgcagtacaaggacttgcccgtgaccttccgggag
ggcgccaaccccggctttcacgaggccattggggacgtgctggccctctcagtgtccacc
cccacgcacctgcaccagattggcctgctgagcagtggggacggcagctatgaggaggat
atcaactttctgatgaagatggcgcttgacaagatcgccttcatccccttcagcttcctc
gtcgaccagtggcgctggagggtgtttgacggaagtgtcaccagggagaactacaaccag
gagtggtggagcctcaggctgaagtaccagggtgtctgtcccccactggccagatctcaa
gacgactttgacccaggggctaagttccacattcctgcaagtgtgccttacgtcaggtac
ttcgtcagcttcgtcatccagttccaattccaccaggcactatgtcaggcggcgggccac
cagggccccctgcacaagtgtgacatctaccagtccaaggaggccgggaagctcctggcg
gatgccatgaagctgggcttcagtcagccgtggcccgaagccatgcggctgatcacgggc
cagtccaacatgtcggctgccgccatgatgacctacttcaagccgctgctggactggctc
gtgacagagaacgggcggcacggggagaagctgggctggcctcagtacaactggacgcca
aactcaggtaccgccccccgcccccctgggccccagggcagccccggggctcgctcaggg
ctggggccctcccaagctaagactcctgtttctgcctccctggatgatcgaggtgaggcc
gtgcctacctgggggatagctgaggaggtggtgacaacaggaagaggggccattccgaca
ttttctgccagtgacctgagagctgagccctgcccgaggctgcccgtcagggaccagctc
tga

DBGET integrated database retrieval system