KEGG   Pantholops hodgsonii (chiru): 102335028Help
Entry
102335028         CDS       T02909                                 

Definition
(RefSeq) glutathione S-transferase 3-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 200 aa AA seqDB search
MYKAVGSRGSRVSRVVWMLEELGEPYEFVPVKLRSPEAYALNPSGKVPILVDDDFVLTDS
AAICVYLAEKHADKGMGANPGLTGRAEMDSWMQFAQSEFEAPLWNKLRHRFILPSELRVD
VGPAATHDFASEVDALDRRLGDKTYALGDRFSAIDVLLGEMGAWARAGKFQIASDRVNAY
MDRVLSRPARTRAQAKCAPA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggccgtcggatcgcgtggatcgcgggtttcccgcgtcgtgtggatgctggag
gagctcggcgaaccttatgaattcgtcccggtgaaattgcgctctccggaagcctatgcg
ctgaacccttccggcaaggtgccgatcctggtcgacgacgacttcgtgctgaccgattcc
gcggccatctgcgtttatctggccgaaaaacatgccgacaagggcatgggcgccaatccg
ggcctcaccggacgcgccgagatggattcctggatgcaattcgcacaatcggaattcgag
gcgccactgtggaacaagctgcgccaccgcttcattctgccaagcgagttgcgggtcgat
gtcggccccgccgccactcatgatttcgcctccgaggtcgacgcgctcgaccgccgactg
ggcgataagacctatgcgctgggcgatcggttttccgcgatcgacgtgctgcttggcgag
atgggcgcctgggcccgcgcgggcaagttccagatcgcgtccgaccgcgtcaacgcctat
atggaccgcgtgctgtcgcgcccggcgcggacacgcgcgcaggccaagtgcgcgcccgcc
taa

DBGET integrated database retrieval system