KEGG   Pantholops hodgsonii (chiru): 102335556Help
Entry
102335556         CDS       T02909                                 

Definition
(RefSeq) beta-glucuronidase-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 893 aa AA seqDB search
MKTLRTILLASCLLSPATLLAAPRDSVSISRDWRFIKGDPAGLTEDLRYDVRPPIEDAGD
GKVADARPDAAVQVDDSGARVLKPWILPSANPFIADPARHHTRPAGNPGGTVSYVQPGFD
DSGWTHVDLPHDWAIAGPFIKDGPYGGMGRLPSWGIGWYRKALTIPASDKGKSIFLDVEG
AMSYATVWLNGKLVGGWPYGYNSFRLDLTPYAVPGGQNQLVIRLDNPQASARWYPGGGLY
RDIYLTTTNKVHVGQWGSIVRTPQVSKAQASVDLSLTLDNDGDTPAQVEVATALYAIDAS
GKRIGRPVASIARQSTSIAPHGKAELKGSTILSNPRLWGPPPTQAPNRYVAVSTVTQGGK
LIDSYETRFGVRDIKFDPDKGVIVNGEQIPLRGVNNHHDLGALGAAFNARAAERQLEILR
DMGTNAVRMSHNPPAPELLELTDRMGFLVMDEVFDSWEKKKTPHDFHLIFPDWHEADARA
MLRRDRNHPSIIIWSIGNEVGEQYDGEAGAKIGRELVAIAHQEDPTRPATSAMNYAKADM
LLPTTVDVISLNYQGAGIRGIVGQYPAFRAKFPDKVILSTESASALSSRGEYMFPVAGAI
SGPVRPWSGGNPDTHQVSAYEMHAADFGSSPDRVWAADDQNPYVAGEFVWTGFDYLGEPT
PYYTSRSSYSGILDLAGFPKDRFWLYQARWRPDLKFAHILPHWTWPDRVGQITPVHVFSS
ADEAELFVNGKSQGKVKKRDYEYRFRWDYVVYEPGEVKVVTWKKGQPWATETIRTVGEAA
KLSLTADRSAIADDGRDLSFVTLKILDKDGNVVPAAKQDIRFSIEGPGEIIATDNGDPTD
LTAFPSHDRKAFNGLALVIVKAKPGEKGRVTVRASAPGLTAAQAVISTNATVR
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctgcgcaccatcctgctcgcctcctgcctgctcagccctgcgaccttgctg
gccgcgccgcgcgacagcgtctcgatcagccgcgactggcgcttcatcaagggcgatccc
gccggcctgaccgaggatttgcgctatgatgtccgtccgccgatcgaggatgccggcgac
ggcaaggtggccgacgcccgccccgacgcggcggtgcaggtagacgacagcggtgcccgc
gtgctcaagccctggatattgcccagcgccaatcccttcatcgccgatcccgccaggcat
cacacccgtcccgccggcaatccgggcggcaccgtctcctatgtccagcccggcttcgac
gacagcggctggacccatgtcgacctgccgcacgactgggcgatcgccggccccttcatc
aaggatggcccctatggcggcatgggccgcctgcccagctggggcattggctggtatcgc
aaggcgctgaccatccccgccagcgacaagggcaagtcgatcttcctcgatgtcgaaggg
gcgatgtcatacgccaccgtctggctcaatggaaagctcgtcggcggctggccctatggc
tataacagcttccgcctcgaccttaccccctatgcggtgccgggcggccagaaccagctc
gtgatccgcctcgacaatccgcaggcttcggcgcgctggtatccgggcggcggcctctat
cgcgacatctatctcaccaccaccaacaaggtccatgtcggccagtggggcagcatcgtc
cgcacgccgcaggtcagcaaggcgcaggccagcgtggacctgagcctcaccctcgacaat
gacggcgacaccccggcgcaggtcgaggtcgcgaccgctctctatgcgatcgacgccagc
ggcaagcgcatcggccgcccggtcgccagcatcgcccgccagtccaccagcatcgccccc
catggcaaggcggagctgaagggcagtacgatcctcagcaacccgcgcctctggggcccg
ccgccgacgcaggcgcccaaccgctatgtcgccgtctccaccgtgacccagggcggcaag
ctgatcgacagctacgaaacccgcttcggcgtgcgcgacatcaaattcgatcccgacaag
ggcgtgatcgtcaatggcgagcagatcccgctgcgcggcgtcaacaatcatcatgatctc
ggcgccctcggcgccgccttcaacgcccgcgccgccgagcggcagctcgaaatattgcgc
gacatgggcaccaacgccgtgcgcatgagccataatccgcccgcgcccgaactgctcgaa
ctcaccgaccgcatgggcttcctggtgatggacgaggtgttcgacagctgggagaagaag
aagaccccgcacgacttccacctgatcttcccggattggcatgaggccgatgcgcgcgcc
atgctgcgccgcgaccgcaaccatccctcgatcatcatctggagcatcggcaacgaggtt
ggcgaacaatatgatggcgaggcgggggcgaagatcggccgcgaactggtcgccatcgcc
catcaggaagacccgacccgtcccgccaccagcgcgatgaactatgctaaggcggacatg
ctgctgccgaccaccgtggacgtcatcagcctcaattatcagggcgccggcattcgcggc
atcgtcggccaatatcccgccttccgcgcgaaattcccggacaaggtcatcctgtccacc
gaaagcgcctcggccctttccagccgcggcgaatatatgttcccggtcgccggcgcgatc
agcggcccggtccgtccctggtccggcggcaatcccgacacgcatcaggtgtcggcctat
gagatgcacgccgccgatttcggctcctcgcccgatcgggtctgggctgccgatgaccag
aatccctatgtcgcgggcgagttcgtctggaccggcttcgattatctcggcgaaccgacc
ccctattacacgtcgcgcagttcctattccggcatcctcgatctcgccggtttccccaag
gaccgcttctggctctaccaggcgcgctggcggcccgacctcaaattcgcgcatatcctg
ccgcactggacctggcctgaccgcgtcggccagatcacgccggtccatgtcttctcctcg
gccgacgaggcggaactgttcgtcaacggcaagtcgcagggcaaggtcaagaagcgcgat
tatgaatatcgcttccgctgggactatgtcgtctatgaaccgggcgaggtgaaggtcgtc
acctggaagaagggccagccctgggcaaccgagacgatccgcaccgtgggcgaggcggcg
aaactgtcgctgaccgccgatcgcagcgccatcgccgatgacggtcgtgacctcagtttc
gtcacgctcaagatcctcgacaaggacggcaatgtcgtccctgccgccaagcaggacatc
cgcttctcgatcgagggaccgggcgagatcattgccaccgacaatggcgacccgaccgat
ctgaccgcctttccgtcgcatgatcgcaaggctttcaacggcttggcgctagtgatcgtg
aaggccaagccgggcgagaaggggcgggtaaccgtccgcgccagcgcaccgggcctgacc
gcggcgcaggccgtcatcagcacaaatgccacagtccgctga

DBGET integrated database retrieval system