KEGG   Pantholops hodgsonii (chiru): 102335745Help
Entry
102335745         CDS       T02909                                 

Definition
(RefSeq) glutathione S-transferase domain-containing protein DDB_G0280881-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 325 aa AA seqDB search
MRGAFLLKRAYRMTDLSAFPITKRWPAQHPDRIQLYSLPTPNGVKVSIMLEETGLPYEPH
LIDIGKNETWGPEFLSLNPNGKIPAIIDPDGPSGQPLGLFESGAILVYLAEKTGLFLPTD
PAARYETLQWVFFQMAAIGPMFGQLGFFHKFAGKEYEDKRPRDRYAAESKRLLGVLEERL
ASRTWIMGDDYTIADIATLGWVRNLVGFYEAGDLVDYGALKHVPRWLEAGLARPAVQRGL
NSPARPSVVEQPAVNRLVVGSNPTRGATLPLGRDFPKALTLNGLKRRVRALWGFAEPALH
GLHRLEAVAITRPLLRATCSAVAQW
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcgcgttcctgctcaagagggcctaccgcatgacggacctatccgcctttccg
atcaccaagcgctggcccgcccagcatcccgaccgcattcagctctattcgctgccgacg
cccaacggggtgaaggtctcgatcatgctggaggagacggggctgccttacgagccccac
ctgatcgacatcggtaagaacgagacctgggggccggaattcctgtcgctgaatccgaac
ggcaagatcccggcgatcatcgatcccgatggtcccagcggtcagccgctgggtctgttc
gagtcgggcgccattctggtctatctggcggaaaagaccggcctgtttctaccgaccgat
ccggcggcgcgctatgagaccttgcagtgggtcttctttcagatggccgccatcggtccg
atgtttggccagttgggcttcttccacaagttcgcgggcaaggagtacgaggacaagcgt
ccgcgcgaccgctacgccgccgagagcaagcgtcttctgggcgtgctggaggagcggctg
gcgtcgcgaacctggatcatgggcgacgactacaccatcgccgacatcgccaccctgggc
tgggtgcgcaacctggtgggcttctacgaagctggcgaccttgtcgattacggcgcgctg
aagcatgtgccgcgctggcttgaagcggggctggcgcggccggccgtgcagcgcggactc
aacagtccagcgcgtccctcagtggtagagcagccggctgttaaccggctggtcgtaggt
tcgaatcctacccgcggagccactcttcctctcggccgtgacttcccaaaggcgctgact
ttgaacgggcttaaacgccgcgtccgcgccttatggggtttcgccgaacccgctcttcat
ggcttgcatcgactcgaagcggtcgctatcacccggcctctcttgagagcgacctgttcc
gcggtagctcagtggtag

DBGET integrated database retrieval system