KEGG   Pseudonocardia sp. HH130630-07: AFB00_06180Help
Entry
AFB00_06180       CDS       T04486                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
phh  Pseudonocardia sp. HH130630-07
Pathway
phh00250  Alanine, aspartate and glutamate metabolism
phh00410  beta-Alanine metabolism
phh00640  Propanoate metabolism
phh00650  Butanoate metabolism
phh01100  Metabolic pathways
phh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AFB00_06180
   00650 Butanoate metabolism
    AFB00_06180
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AFB00_06180
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AFB00_06180
Enzymes [BR:phh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AFB00_06180
Amino acid related enzymes [BR:phh01007]
 Aminotransferase (transaminase)
  Class III
   AFB00_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANY05959
UniProt: A0A1B1ZJM9
LinkDB All DBs
Position
complement(1292637..1293893)
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLFDTEGRRHLDFTAGIGVTSTGHCHPAVVQAAQEQVA
TLIHGQYTTVMHQPLLTLVERMGQVLPEGIDTVFFTNSGSEAVEASVRLARQATGRQLIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFAPFPYAYRYGWSEEQAVEFALTEL
DRQLASTAPAADVAAFIVEPVLGEGGYVPTPAAFLQGLRERADRHGILLIADEVQTGYGR
TGKFWGHQHAEGVVPDVIVTAKGLASGFPLSAIAAPKALMEKAWPGSQGGTYGGNAVACA
AAVATLDVVLGENLVENSRVQGERLVAGVRAAAQGVAAIGDVRGRGLMVGIEFVDAEGEP
DGATAAKVHAAAAEQGLLLLTCGVYGNVVRMIPPLVVTAEQVDEGLALWSKALAGALG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctgaagcaggccaccccggtccaggccgcccgtggcgaa
ggcgtctacctgttcgacaccgagggccgccgccacctcgacttcaccgcaggcatcggc
gtcacctcgaccgggcactgccacccggccgtggtccaggcggcccaggagcaggtcgcg
accctgatccacggccagtacacgacggtcatgcaccagccgctgctcaccctcgtcgag
cggatggggcaggtgctgcccgagggcatcgacacggtgttcttcaccaactccggctcc
gaggccgtcgaggcgtcggtccggctcgcccggcaggcgaccggccggcagctgatcgtc
gcgttcgacggcggcttccacggccgcacgatgggcgcggccgcgctcaccacctccggc
gccaagatccgtgcggggatcggcccgatgatgggcggcgtcgcgttcgcgccgttcccc
tacgcctaccgctacggctggtcggaggaacaggccgtcgagttcgcgctgaccgagctg
gaccgccagctcgcgagcaccgccccggcggcggacgtcgcggcgttcatcgtcgagccg
gtgctgggcgagggcggctacgtgccgacgccggccgcgttcctgcagggcctgcgcgag
cgggccgaccggcacggcatcctgctgatcgccgacgaggtgcagaccggctacggccgc
accgggaagttctggggccaccagcacgccgagggtgtcgtgccggacgtcatcgtgacg
gcgaagggcctcgcctccggcttcccgctgtcggcgatcgccgccccgaaggcgctgatg
gagaaggcctggcccggctcgcagggcgggacctacggcggcaacgcggtggcctgcgcg
gccgccgtcgccaccctggacgtcgtgctgggggagaacctggtggagaactcccgggtg
cagggcgagcgcctggtggccggggtccgcgccgccgcgcaaggggtcgccgcgatcggc
gacgtccgcggccggggcctcatggtgggcatcgagttcgtcgacgccgagggcgagccg
gacggtgccaccgccgcgaaggtgcacgccgccgccgcggagcagggcctgctgctgctg
acctgcggggtgtacggcaacgtcgtccggatgatcccgccgctggtcgtgacggccgag
caggtcgacgagggcctcgcgctctggtccaaggcgctcgccggcgcgctcggctga

DBGET integrated database retrieval system