KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102099648Help
Entry
102099648         CDS       T02921                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102099648 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102099648 (NEU2)
Enzymes [BR:phi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102099648 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 398 aa AA seqDB search
MLNCIEQAAVPQCANPCSTMAAFPVLEQETLFQNGTWSYRIPALLYLPRFSMILAFAEER
EDLVDEHAKLIAMRRGVYDPATQHVQWKRMETLVSAQLEDHRSMNPCPVYDEVSGKLILF
FIAVPGKISEQHQLRTKINLVRLCYVTSMDQGRTWSTAQDVTDRTIRNEYKNWATFAVGP
GHGLQLLNEARSLVIPAYAYRILDPKQHPTPHAFCFISSDHGTTWEKGNFVGEESAVECQ
VAEVHSCGRKVLYCNARSNRGARIQAVSYNHGLDFEGGQRVETLIEPPSGCHGSVTAFPP
PPDARCQDSWLLYAHPTDPRGRKDLGIYLNKNPLNPGHWTKPSILFKGLCAYSDLQYMGT
GPDGSPLFSCLFEYGTHRQCEEIIFVMFTLKQAFPSEH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactgtatagaacaagcagctgtgccacagtgtgccaacccatgcagcacaatg
gctgcgttccctgtcttggagcaagaaacattattccagaacggtacctggagctatcga
attccagccctgctctacctgccacggttcagcatgatcctggcctttgctgaggaacga
gaggacctggtggatgaacacgccaagctgatagccatgcgcagaggcgtgtatgaccca
gccacgcagcacgttcagtggaaaaggatggagacccttgtcagtgcacagctggaggac
caccgatctatgaatccttgcccggtatatgatgaggtctcgggaaaactcatcttgttc
ttcatagctgtcccaggaaagatctctgagcagcatcagctgaggacaaagatcaacctg
gtacgtctctgctatgtcactagcatggaccaaggacgcacctggagcactgcccaggat
gtcaccgacaggaccattaggaatgagtacaagaactgggccacgtttgcagtggggcca
ggccatggattacaattgctcaacgaggcccggagccttgtgattcctgcctacgcctat
cgtatcttggatcccaagcaacaccccacccctcatgccttctgcttcatcagctctgac
catgggacaacatgggagaaggggaactttgtgggggaggagagtgcggtggagtgtcag
gtagcagaggtgcatagctgtggcagaaaggtcctttattgcaatgcaaggagcaacagg
ggagccaggatccaggctgtcagctacaaccatgggctggactttgagggaggccagagg
gttgaaacgctaatagaacctccctctggatgccatggaagtgttactgcctttccacct
cccccagatgccagatgtcaagatagttggttactctatgctcatcctacagacccaagg
ggtcgaaaagatttaggaatttacctcaacaaaaaccctttaaatccaggacactggaca
aaacccagcatactcttcaagggcctgtgtgcttattcagatctgcagtatatgggcact
gggcctgatggctcacctttgttctcttgcctctttgaatatgggacccacagacaatgt
gaagagattatttttgtcatgttcaccttgaagcaagcctttccctcggaacactga

DBGET integrated database retrieval system