KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102102011Help
Entry
102102011         CDS       T02921                                 

Gene name
KMT5B, SUV420H1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102102011 (KMT5B)
Enzymes [BR:phi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102102011 (KMT5B)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102102011 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 854 aa AA seqDB search
MKWLGESKNMVVNGRRSGSRSSNDHAQTKLQHAGKENPKTGKNGVERRSSRCSGASGFEG
QSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIERFK
KDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRYSS
EQNGAKIVATKEWKRNDKIELLVGCIAELSEMEENMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYTCE
RRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTT
QEKGNATSRKSSIGVKKNSKNRTLTRQSISRIPASSNSTSSKLTHINNSRVPKRLKKPAK
PLLSKIKLRNQCKRPEQKNASRKLEMGNLVLKEPKVVLYKNLPIKKDKELEGPVKVAVSS
GCLTRHAAREHKLNSVKGAYEHGDIAPCTYITRRSMRTRMSLKETSDTKLEPNTLDSYKS
NLTGTQSDVAEQQSRALNDNDVAHGPSHKGEGRCQKSDAGTSKKKSRQGKLMKPSSKTEE
TDTMHNTPVKDEVPDLISSHSELEERNNMVDTPVGFKDCIPGSGGCSVTTDNFKAKDSFR
TAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSSSKANDQESDGMNSSKISIKLSKD
HEKDNNLYVAKLNNGFNSGSGNSSTKLKIQLKREDENRGTYPEDLHENGVCCSETLSLLE
SRMEVDDYGHYEEETADESSSEEDDEEEDDYDDEFDDFIPLPPAKRLRLIVGKDSIDIDI
SSRRREDQSLRLNA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggctgggagaatccaagaacatggtagtgaatggccggagaagtggaagcagg
tcatctaatgaccacgcgcagaccaaattgcagcatgcaggaaaggagaatccaaagacg
ggcaaaaatggagttgagagaagatcaagcagatgtagcggtgcttcaggatttgagggt
caaagtcgttatgtgccttcctctggaatgtctgccaaggaactctgtgaaaatgatgac
ctagcaactagtttggttcttgatccctatttaggttttcagacacacaaaatgaatact
agatttcgacctattaaaggaaggcaagaagaactcaaagaggtgattgaacgttttaag
aaagatgagcacttagaaaaagccttcaagtccttgacgtcaggtgactgggcccggcac
tattttcttaacaagaacaaaatgcaggaaaggttgttcaaggaacatgtatttatttat
ttacgaatgtttgcaactgacagtgggtttgagatactgccttgcaatcggtattcttct
gagcaaaatggagccaaaatcgttgcaacaaaagaatggaaacgaaatgataaaatagaa
ttacttgtgggctgtattgctgaactatcagaaatggaagaaaacatgctgctgagacat
ggggaaaatgacttcagcgtcatgtattccacacgaaaaaactgtgcacaactgtggctt
ggtcctgctgcatttatcaatcatgattgcagacctaactgtaagtttgtatcaacgggc
agagatacagcatgtgtgaaagctctaagagatattgaacctggagaagaaatctcttgt
tactacggagatgggttttttggagaaaataatgaatattgcgaatgttatacctgtgaa
agacgtggaactggtgcttttaaatcaagagtgggattgccagcacctactcctgtgatt
aacagtaaatatggactgagagaaacagacaaacgattgaacagacttaaaaagttgggt
gacagcagcaagaattcagacagccagtccgtcagctctaacactgatgcagataccact
caggaaaaaggtaatgcaactagcagaaaatcttcaattggtgtaaaaaagaacagcaaa
aatagaacgttaaccagacagtctatatcaagaattccagcatcatcaaattctacctca
tctaaactaactcatataaataattccagggtaccaaagagactgaaaaagcctgcaaag
cctttactttcaaagataaagttgagaaatcagtgcaaaaggccagagcaaaagaatgct
tctcgaaagcttgaaatgggaaatttagttctcaaagagcctaaagtagttttgtataaa
aacttgcccattaaaaaggataaagaattggagggaccagtcaaagttgcagtctctagc
ggatgcttaacgaggcatgcagcaagagaacataaactgaattctgtgaaaggtgcttat
gagcatggtgatattgcaccctgcacatatatcacaaggaggtcgatgagaacaaggatg
agtttgaaggagacctctgacacaaagcttgaaccaaatacgttggatagctataagagt
aacttgactggaacacaatcggacgttgcagagcagcagtctcgtgcattaaacgacaac
gatgtggctcatggaccatcacataaaggggagggtcggtgccagaaaagtgatgcaggc
acgtcaaaaaagaaatctcgacaagggaagcttatgaaaccatcttcaaaaacagaggaa
actgatactatgcacaacacacctgtgaaggatgaagtaccagatttgatcagttctcat
tcagaactcgaagaaaggaataacatggtggacacacctgttggctttaaagactgtatc
cctggatctggtggctgctctgtaacaactgacaattttaaagcaaaagacagctttaga
actgcaaaaagtaaaaagaaaagacgaattacgaggtatgatgcacaacttatccttgaa
aatagctctgggatccctaaactgactcttcgtaggcgccatgatagcagtagcaaggca
aatgatcaagagagtgatggcatgaattcttcaaaaataagcataaaattaagtaaagac
catgaaaaagataataatttatatgtagcaaagctaaataatgggtttaactcaggatca
ggcaatagttcaacaaaattaaaaatacagctaaaacgagaggatgaaaacagagggacg
tacccagaggaccttcatgaaaatggtgtgtgttgtagtgaaactctctcccttttggag
tcgagaatggaagtagatgattatggtcactatgaagaggaaacagcagatgaatcttca
tcagaagaggacgatgaagaggaagatgactatgatgatgaatttgatgactttattcct
cttcctccagcgaagagattaaggcttattgttggcaaggattcaatagatattgatatt
tcttccaggaggagagaagatcagtctttaaggctcaatgcgtaa

DBGET integrated database retrieval system