KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102107270Help
Entry
102107270         CDS       T02921                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Brite
Enzymes [BR:phi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102107270 (HDAC7)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102107270 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 988 aa AA seqDB search
MRSRGFPGAELAGCSQGAAPGLEISTTLVMFSPSSAVTPCTSPRVPQAVPMDLRIGQRVV
KPQDTALLALKQQQLQHQLFLASLHQQQVEQLAHQHVRVAMESPHREAEPGQQEQELRQI
LNKDKSKRSAVASTVVKQKLAEVILKKQQAALERTSNAPATALPYRSLEPLEPEGPSPAM
LSTFLSPVASASLDPPEHFPLRKTASEPNLKVRCKPRKCLDRRKNPLTRKESAPPSLKRR
PPEAIDSSPSSSSTPVSGCSSPNDSLPAEHAALPAAPGAAHEGEAERRALPSLAHRVPVL
NGPVLPGTHSPVFIPASLEQHEAGGPLSPRLQPVIILEPSVSHAPLVAVPGLGTVPFSFA
PSLIPAERLSLPGHHKPLGRTRSEPLPPSPKAVQQHLLFQQHHAHFLERLKQQTHLGKRM
AKPSEKPRLRQIPSSEDMEAEGTLPEAAAEGGDPGRARLEPPRPGSSGKEPERTQKMGQP
QEELVLQQALLWDSFQRVQQQLLKRQPLADPPVVPPGHRPLSRAQSSPATASASLPAQDT
KALALPVQEPQPHFTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRSRC
ECLRGRKATLEELQCVHSERHVLLYGTNPLNRLKLDNGKLAGILSQRTFVMLPCGGVGVD
SDTIWNELHSSNAARWAAGSVTELAFKVATRELKNGFAVVRPPGHHADPSTAMGFCFFNS
VAIAARQLQQKGKLSKILIVDWDVHHGNGTQQIFYRDPEVLYISLHRHDDGNFFPGSGAA
DEVGAGPGEGFNVNVAWAGGLDPPMGDPEYLAAFRTVVMPIAQEFCPDVVLVSAGFDAAE
GHPPPLGGYKVSAKCFGYMTKQLMSLAGGAVVLALEGGHDLTAICDASEACVSALLGHEP
EPLPEESVRQKPNANAVRSLEAVIQVQSKYWVAVQRFASKLGCSFLEAQHHEADEVETVT
ALASLSVAVMVEKRAQEEPMEQEEPMNQ
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgaggagccgcggctttccgggagcggaactcgctggatgttctcagggcgctgcgccg
gggttggagatctccaccacgctggtgatgttcagcccgtcctctgctgtgaccccgtgc
acctccccgcgggtgccccaggccgtccccatggacctgaggatcgggcagcgcgtggtc
aagccccaggacacggctctgctggccctgaagcagcagcagctgcagcaccagctcttc
ctggccagcctgcaccagcagcaagtggagcagctcgcccaccagcacgtcagagtggcc
atggagtccccgcaccgcgaggctgagccgggccagcaggagcaggagctgcggcagatc
ctcaacaaggacaagagcaagaggagtgccgtggccagcacggtggtgaagcagaagttg
gccgaggtcatcctgaagaagcagcaggcggctctggagagaaccagcaacgcccccgct
accgccctgccctacaggtctctggagcctctggagcccgagggtccctcccctgccatg
ctcagcacattcctgtcccccgtggccagcgcttccctcgacccccccgagcatttcccg
ctgcggaaaacagcgtccgagcccaacctgaaggtgcggtgcaagcccaggaagtgcctg
gaccggcgcaagaaccccctgacccgcaaggagagcgctcccccctcgctgaagaggcgc
ccgcccgaggccatcgactcgtcccccagcagcagcagcacccccgtgtccggctgcagc
tctcccaacgacagcctgcccgccgagcacgcggctctgcccgcggccccgggagcagcc
cacgagggcgaggccgagcgccgggcgctgcccagcctggctcaccgcgtgccggtgctc
aacgggccggtgctcccgggcacgcactcgcccgtcttcatcccggccagcctggagcag
cacgaggccggcggccccctgtcccctcggctgcagcccgtcatcatcctcgagccctcg
gtcagccacgctccgctggtggcggtgccaggcctggggaccgtccccttctccttcgcc
ccctcgctcatccccgccgagcgcctgtccctgcccggccaccacaaaccgctgggcagg
acccgctcggagccgctgccacccagccccaaggcggtgcagcagcacctgctgttccag
cagcaccacgcgcatttcctcgagaggctcaagcagcaaacgcacctgggcaagcgcatg
gccaagcccagcgagaagccccggctgcggcagatcccgtcctcggaggacatggaggcc
gaggggacgctcccggaggccgcggccgagggcggggaccccggcagggcacggctggag
cccccccggcccggcagcagcgggaaggagcccgagaggacgcagaagatggggcagccc
caggaggagctggtcctgcagcaggccttgctgtgggactcgttccagcgggtgcagcag
cagctcctcaagcgccagcccttggccgacccccccgtggtgccccccggccaccgaccc
ctgtccagggcccaatcgtccccggccacggccagcgcgtccctccctgcccaggacacc
aaggctctggccctgcccgtgcaggagccccagccacacttcaccacagggctggtttac
gactcggtgatgctgaagcaccaatgctcctgtggagacaacagcaaccaccccgagcac
gccgggaggatccagagcatctggtcccggctgcaggagcggggcctgcgcagccgctgc
gagtgcctgcggggccgcaaggccaccctggaggagctgcagtgcgtccacagcgagcgc
cacgtcctcctctacggcaccaaccccctcaaccgcctcaaactggacaatgggaagctg
gcagggatcttgtcccagaggacgtttgtgatgctgccctgcggaggggtgggggtggac
agtgacaccatctggaacgagctgcactcatccaacgctgcccgctgggccgccggcagc
gtcaccgagctggccttcaaggtggccaccagggagctgaagaacggttttgccgtggtg
cggccgcccggacaccacgcggacccttccacggccatgggattctgcttctttaactcc
gtggccatcgcagcccggcagctgcagcagaaggggaagctcagcaagatcctcatcgtg
gactgggacgttcaccacggcaacgggacccagcagattttctacagggaccccgaggtt
ctctacatctccctgcaccgccacgacgacgggaatttcttcccgggcagcggagccgcc
gacgaggtgggcgctggccccggcgagggcttcaatgtcaacgtggcctgggctgggggg
ctcgacccccccatgggggaccccgagtacctggctgccttcaggaccgtggtgatgcca
attgcccaggagttctgccccgatgtggtgctggtctcagccggcttcgacgcggccgag
ggccacccaccccccctgggtggctacaaagtctctgccaagtgttttggctacatgacc
aagcagctgatgagcctggccgggggggccgtggtgctggcgctggaggggggccacgac
ctcacggccatttgtgacgcgtccgaggcctgcgtgtccgccctgctgggccacgagccg
gagccgctcccggaggagagcgtgaggcagaagcccaacgccaacgccgtgcgctccctg
gaagccgtgatccaggtgcagagtaaatactgggtggccgtgcagcgcttcgcctccaag
ctgggctgctccttcctcgaggctcagcaccacgaggccgacgaggtggagacggtcacg
gccctggcgtcgctctcggtggccgtgatggtggagaagagggcgcaggaggagccgatg
gagcaggaggagcccatgaaccagtga

DBGET integrated database retrieval system