KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110318Help
Entry
102110318         CDS       T02921                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102110318 (OGDHL)
  Amino acid metabolism
   00310 Lysine degradation
    102110318 (OGDHL)
   00380 Tryptophan metabolism
    102110318 (OGDHL)
Enzymes [BR:phi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     102110318 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1012 aa AA seqDB search
MSHLKLFAAVLKRHGFKLLEKQDIARRAFLHGQRYVSSGTSQPFLSGSNSNYMEEMYHAW
LENPESVHKSWDVFFRSANTGQATHLPAQLEGKGSFLQSHGLAPAPGTAEKVVEDHLAVQ
SLIRAYQIRGHHVAQLDPLGILDADLDSFIPSDLITTIDKLGFYGLHESDLDKVFQLPTT
TFIGGNENSLSLREIIKRLEHTYCQHIGLEFMFINDVEQCQWIRQKFETPGIMKFSNEDK
RTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIEYVIMGMPH
RGRLNVLANVIRKELEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRKTNKKITLSLM
ANPSHLEAVDPVVQGKTKAEQFYRGDTAGKKVMSILLHGDAAFAGQGVVYETFHLSDLPS
YTTNGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMYVCNVAA
EWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKLIADGTVT
LQEFEEEIAKYDRICEEAYTRSKDNKILHIKHWLDSPWPGFFNVDGEPKSMSCPPTGISE
ELLTHIGNVASSVPVKDFKIHSGLSRILKARLEMTNNRLVDWALAEYMAFGSVLKEGIHV
RLSGQDVERGTFSHRHHVLHDQEVDKRTCVPMNHLWEQQAPYTVCNSSLSEYGVLGFELG
FAMASPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEGMGPEHS
SARPERFLQMSNDDSDAYPEFTEEFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRK
PLIVLTPKSLLRHPEAKSSFDEMVSGTTFQRVIPENGLAAQAAHEVKRVIFCTGKVYYDL
VKERKNQDLEKQVAITRLEQISPFPFDLLKEELDKYPTADLVWCQEEHKNSGYYDYVKPR
FRTIVNHTRPIWYVGREPAAAAATGNKNMHLVSLRRFLDTAFNLEAFEGKTF
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatctgaagttgtttgcagctgtgctgaagaggcatggctttaaacttttggaa
aagcaggatatagccagaagggcatttttacatggccaacggtacgtttcatcaggaacc
tcacagccattcctgagtgggagtaattccaattacatggaggaaatgtaccatgcatgg
cttgaaaaccctgaaagcgtacataagtcctgggatgtgtttttccgaagtgctaacact
ggccaagcaacccatctaccagctcaactggaaggaaagggatcatttctgcagagccac
ggcctggccccagcaccagggacggctgaaaaggttgttgaagatcaccttgctgtgcag
tcattgataagagcataccaaatccgtggccatcatgtggctcagctagatccccttgga
attctggatgcagatttggattcatttattccgtctgaccttattaccacaatcgataaa
cttgggttttatggtttgcatgaatcagatttggacaaagtctttcagctgccgacaacc
accttcataggaggaaatgagaacagtctttctttgcgagagatcatcaaacgcctggag
catacctactgccaacacattggcctggagtttatgttcatcaacgatgtggagcagtgc
cagtggatccgtcagaagtttgagacgccgggaatcatgaagttctcaaacgaagataaa
aggactttgctggcaaggctggtgcgctctatgaggtttgaagacttccttgctcgcaag
tggtcttctgaaaagagatttggtttggaaggatgtgaagtaatgattccagcacttaag
actatcattgataaatccagtgaaatgggaattgaatatgttataatgggaatgcctcac
agaggtcggctgaatgtattggctaatgtaatccgaaaagagctggagcagatcttctgt
cagtttgatcccaaacttgaagcagctgatgagggatctggggatgtaaaataccacctg
ggaatgtatcatgagaggatcaaccgaaaaacaaacaagaaaatcactctgtccctgatg
gctaacccttctcacttggaagcagttgatcctgttgtgcaaggcaagacaaaagctgaa
cagttttatcgaggggatacagcagggaaaaaggttatgtccatattattacatggggat
gctgcctttgcaggacaaggagtggtttatgagacatttcatcttagtgacctcccatct
tacactacaaatggcactatccatgttgtggtcaacaaccagattggcttcaccacagac
ccccgtatggcccgttcatctccatatcccactgatgttgctcgtgtggtcaatgctccc
attttccacgtgaatgctgatgaccctgaagcagtgatgtacgtgtgcaacgtagctgca
gagtggagaaacactttcaataaggatgtggtcgttgacttggtttgttaccgtaggaga
gggcacaacgaaatggatgagcccatgttcacccagcctctgatgtacaagcagatccat
aagcaggtgccggtgctgaagaaatatgctgacaaactgattgcagatgggactgtgaca
ctgcaggagtttgaggaagaaattgcaaagtatgatagaatatgtgaagaagcatatact
agatctaaagataataagatcctgcatatcaagcactggctggattcaccttggcctggc
ttctttaacgtggatggagagcccaagagcatgtcttgtcctccaacaggcatttcagaa
gagctgctgactcacattggcaatgttgctagttcagtgccagtcaaagacttcaaaata
cactcaggactctctcggattttgaaagcccgcttggaaatgaccaacaacaggcttgtt
gactgggccttagcagaatacatggcttttggctctgttctcaaagaagggatacatgtc
cgactgagtggccaggatgtggagagaggtactttcagccatcgtcaccatgtgcttcac
gatcaagaagttgacaagagaacttgtgttcccatgaatcacctctgggagcagcaggcc
ccctacaccgtgtgcaacagttctctctctgagtacggggtcttgggttttgaacttggc
tttgctatggcgagtcccaatgctctggtgtgctgggaagcccagtttggggacttccac
aacacggctcagtgtatcatagaccagttcatcagctctggccaggccaagtgggttcgg
cacaacgggatcgtcctgctcctgccacacgggatggaaggaatgggtccagagcattca
tcagccagacctgagaggtttctgcagatgagcaatgatgattctgatgcctatccagag
ttcactgaggagtttgaagtttcccagctatatgattgcaactggattgtggtgaactgt
tcaactccagccaattactttcatgtcctccgaaggcagatcttgctgccattcagaaag
ccgctgattgttttgacacccaagtcactgctgaggcatccagaagctaaatccagtttt
gatgaaatggtgtctggtaccactttccaacgtgtgattcctgagaatgggctggcagcc
caggcagcacatgaggtcaagcgagtgattttctgcacaggaaaagtctactatgacctt
gtgaaagagagaaagaaccaagacctggagaaacaagtagctataaccagacttgaacag
atctcaccattcccctttgacttgctgaaagaggaacttgataagtatccaactgctgat
ctagtctggtgtcaggaggagcacaaaaacagtggatattatgattatgtcaaacctcgt
ttccgcactattgtgaaccacactcgacccatctggtatgttggccgagagcctgctgct
gcagctgccacaggcaacaagaacatgcatctggtgtcgctcagaaggttcttggataca
gctttcaacctggaggcctttgagggaaagacattctaa

DBGET integrated database retrieval system