KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102110616Help
Entry
102110616         CDS       T02921                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102110616 (SUV39H1)
Enzymes [BR:phi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102110616 (SUV39H1)
Chromosome [BR:phi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102110616 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102110616 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 414 aa AA seqDB search
MAENLKGCSVCCLSPWSRLQELCRLQRLRCRALGVTRRNLGHFEVELLCDYRRVRDEEFY
LVKWRGYPTSANTWEPRRNLRCRGLLQQLHRDLARAPGAPVRPGPRGLPPRAVSYLAQKA
EQRRALRRWERHLNRTRSHRGRIAVENEVDLHGPPRDFVYVNEYKVGAGVALTPVAAGCE
CRDCLAEATLAGGCCPGASHNRFAYNEAGQVRIRAGLPIYECNSRCRCGADCPNRVVQRG
IRYDLCIFRTGDGRGWGVRTLQRIRKNSFVMEYVGEIITSEEAERRGQVYDRQGATYLFD
LDYVEDVYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDQRLPRIALFATRPIRAGEE
LTFDYNMHVDPVDAESSRMDSNFGLVGGSLGGSPRARGRIECKCGAASCRKFLF
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgctccgtgtgctgcctgtcgccctggtcgcgactgcag
gagctgtgccggctgcagcgcctgcggtgccgcgcgctcggcgtcacccgccgcaacctc
ggccacttcgaggtggagctgctgtgcgactaccggcgagtgcgggacgaggaattctac
ctggtgaagtggcgcggttaccccacctccgccaacacctgggagccgcgccgcaacctc
cgctgccgcgggctccttcagcagctacaccgcgacctggcgcgcgcccccggcgctccg
gtgcggccgggcccccgcgggctcccgccgcgcgccgtctcctacctggcgcagaaagcc
gagcagcgccgggcgctgcggcgctgggagcggcacctgaaccgcacgcgcagccaccgc
ggccgcatcgccgtggagaacgaggtggacctgcacgggcccccccgggatttcgtctac
gtcaacgagtacaaggtgggcgcgggcgtggcgctgacgccggtggcggccggctgcgag
tgccgcgattgcctggccgaggccacgctggccgggggctgctgcccgggcgcgtcccac
aacaggttcgcctacaacgaggccgggcaggtgaggatcagggcggggctgcccatctac
gagtgcaactcgcgctgtcgctgcggcgccgactgtcccaaccgcgtggtgcagcgcggc
atccgctacgacctgtgcatcttccgcaccggcgacgggcgcggctggggagtgcgcacg
ctgcagcgcatccgcaagaactccttcgtcatggagtatgtgggggagatcatcacctcg
gaggaggcggagcgccggggccaggtgtacgaccgccagggcgccacgtacctgttcgac
ctggactacgtggaggacgtttacaccgtggacgccgcccactacgggaacatctcacac
ttcgtcaaccacagctgcgaccccaacctgcaggtgtacaacgtgttcatcgagaacctg
gaccagcggctgccgcgcatcgcgctgttcgccacgcgcccgatccgcgccggggaggag
ctcaccttcgactacaacatgcacgtggacccggtggacgccgagagcagccgcatggac
tccaacttcgggctggtgggggggtccctggggggctccccccgcgcccgcggccgcatc
gagtgcaagtgcggggcggcctcgtgccgcaaattcctgttctga

DBGET integrated database retrieval system