KEGG   Pseudopodoces humilis (Tibetan ground-tit): 102112613Help
Entry
102112613         CDS       T02921                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
phi  Pseudopodoces humilis (Tibetan ground-tit)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    102112613 (ABAT)
   00650 Butanoate metabolism
    102112613 (ABAT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102112613 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102112613 (ABAT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102112613 (ABAT)
Enzymes [BR:phi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102112613 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102112613 (ABAT)
Amino acid related enzymes [BR:phi01007]
 Aminotransferase (transaminase)
  Class III
   102112613 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASMLLSRQLTCCLQQNSRLLVFGHRYISQAAAKIDVDFDYDGPLMKTEVPGPRSRELMK
KLNDIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPSLIKLLQQPQ
NLSTFINRPALGILPPENFTEKLHESLLSVAPKGLSQVMTMSCGSCSNENAFKAIFMWYR
NKERGHNNVTKEELESCMINQPPGCPDYAMLSFMGGFHGRTLGCLATTHSKAIHKLDIPS
LDWPIAPFPRLKYPLEDFVKENQQEEARCLEEVEDLIVKYRKKKKIVAGIIVEPIQSEGG
DNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVVTFSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLMLAEVIKVIKTEDLLNNATHAGKALLTGLL
DLQARYPHLISRVRGRGTFCSFDTPNDATRNKLITIARNKGVVLGGCGDRSIRFRPTLIF
KDHHAHLFLNIFSDILANFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatgttgcttagtcgacagctgacctgttgcctgcagcaaaactccagactg
ctggtgtttggacacaggtatatcagtcaagctgcagctaaaattgatgtggattttgat
tatgatggacctctgatgaagacagaagttcctggaccacgatctagagaattaatgaag
aagctgaatgacattcagaatgcagaagctgtgcacttcttttgcaattatgaagagagc
cgagggaactaccttgtagatgtagacggcaatcgaatgttggatctctactctcagatt
tcttccatcccaataggttacagccatccctctctgatcaagcttttacagcagccacag
aacctgagcacttttatcaacagacctgccctagggattttacctccagagaacttcaca
gaaaaactgcatgagtctttgttatcagtggctcctaagggcttgtcacaggtgatgacc
atgtcttgtggatcctgctctaatgaaaatgcctttaaagcaatattcatgtggtacaga
aacaaggagaggggccataataatgtcacgaaagaagaactggaatcttgcatgattaac
cagccccccggctgccctgactacgccatgctctccttcatgggtggcttccacggcagg
accctgggttgcttagctacaactcactctaaagcaattcacaaactggacattccctca
ctggactggcctattgctccatttccaagactaaagtatcccctggaggactttgtgaaa
gagaatcaacaggaagaagcccgttgtttagaggaggtggaagacctgattgtaaagtac
aggaaaaagaagaagattgtggctggaatcattgtggaaccaatacagtcagagggtggg
gacaatcatgcttcagatgacttcttcagaaagctacgagatattgccagaaagcatggc
tgtgctttcctggtggacgaggtgcagacaggaggcggctgcacaggaaaattctgggcc
catgagcactggggcctggatgacccagctgatgtggtaacgttcagtaagaagatgatg
acaggaggatttttccacaaagaggagttcaggccaaatgctccctaccggatttttaac
acctggcttggagatccatccaagaaccttatgcttgctgaagtcattaaggttattaaa
acagaagaccttctaaacaatgcaacccatgctgggaaagcactactgactgggctgctg
gatttgcaggctcgttacccccatctcatcagcagagtgagaggaagaggaacattctgt
tcatttgacactccaaatgatgcaactagaaacaagttaattacaatagccagaaacaaa
ggtgttgttctgggaggctgtggagacagatccatccgttttcgtccaacactgatcttc
aaggatcaccacgcgcacctctttctgaacattttcagtgacatcttagcaaacttcaag
taa

DBGET integrated database retrieval system