KEGG   Pyrococcus horikoshii: PH0570Help
Entry
PH0570            CDS       T00014                                 

Gene name
PH0570
Definition
(GenBank) 478aa long hypothetical pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
pho  Pyrococcus horikoshii
Pathway
pho00010  Glycolysis / Gluconeogenesis
pho00230  Purine metabolism
pho00620  Pyruvate metabolism
pho01100  Metabolic pathways
pho01110  Biosynthesis of secondary metabolites
pho01120  Microbial metabolism in diverse environments
pho01130  Biosynthesis of antibiotics
pho01200  Carbon metabolism
pho01230  Biosynthesis of amino acids
Module
pho_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pho_M00002  Glycolysis, core module involving three-carbon compounds
pho_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0570 (PH0570)
   00620 Pyruvate metabolism
    PH0570 (PH0570)
  Nucleotide metabolism
   00230 Purine metabolism
    PH0570 (PH0570)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     PH0570 (PH0570)
Membrane trafficking [BR:pho04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PH0570 (PH0570)
Exosome [BR:pho04147]
 Exosomal proteins
  Proteins found in most exosomes
   PH0570 (PH0570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C IMPDH HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: BAA29659
UniProt: O73980
LinkDB All DBs
Position
complement(508785..510221)
Genome map
AA seq 478 aa AA seqDB search
MRRMKLPSHKTKIVATIGPATNSKKMIKKLIEAGMNVARINFSHGTFEEHAKIIEMVREQ
SQKLDRRVAILADLPGLKIRVGEIKGGYVELERGEKVTLTTKDIEGDETTIPVEYKDFPK
LVSKGDVIYLSDGYIVLRVEDVKENEVEAVVISGGKLFSRKGINIPKAYLPVEAITPRDI
EIMKFAIEHGVDAIGLSFVGNVYDVLKAKSFLERNGAGDTFVIAKIERPDAVRNFNEILN
AADGIMIARGDLGVEMPIEQLPILQKRLIRKANMEGKPVITATQMLVSMTMEKVPTRAEV
TDVANAILDGTDAVMLSEETAVGKFPIEAVEMMARIAKVTEEYRESFGITRMREFLEGTK
RGTIKEAITRSIIDAICTIGIKFILTPTKTGRTARLISRFKPKQWILAFSTREKVCNNLM
FSYGVYPFCMEEGFNENDIVRLIKGLGLVGSDDIVLMTEGKPIEKTVGTNSIKIFQIA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggatgaagcttccctcccataaaacaaagattgtcgcaacgatagggccggca
actaactcgaaaaaaatgatcaaaaaattaattgaagctggcatgaacgttgcaagaata
aacttttctcatggcacattcgaagagcatgcaaagatcatagagatggtgagggaacag
tcacagaagttagataggagagttgcaatattagccgaccttcccggactgaagattagg
gttggggagataaaggggggatatgtggaacttgaaagaggggagaaagttactttgaca
acaaaagatattgagggagatgaaacaacgatccccgtagaatataaggatttcccaaag
cttgtatctaagggagatgtgatatacctaagcgatggctatatagtgttaagagtcgaa
gatgtaaaggagaatgaagttgaagcagtagttatttctggtggaaaactcttctcgagg
aaagggataaacattccaaaggcctatcttcccgttgaagctataactccaagagatata
gagataatgaagttcgcaatcgaacatggcgtcgatgcaataggactcagctttgttgga
aacgtttacgatgtactaaaagcgaagagctttttggagagaaatggcgcaggtgacacc
ttcgttatagctaagatcgaaagacccgatgctgttagaaacttcaatgaaattctaaat
gccgctgacgggattatgatagccaggggtgatctaggggttgagatgccaatagaacaa
cttccaattctccagaagaggttaattaggaaagccaacatggaaggaaagcctgtaatt
acggcaacccagatgctcgtttccatgacaatggaaaaagtcccaacaagagctgaagtt
acagacgttgccaatgcaatactagatggaaccgatgccgttatgttgtctgaagaaaca
gcagttggaaaattcccgattgaggccgtcgagatgatggcaaggatagcgaaagtaact
gaggaatatagggaaagctttgggataaccagaatgcgagagttcctggaaggaacgaag
aggggaacgataaaggaggcgataaccaggagtatcattgatgccatctgcactataggt
ataaagttcatattgacgccaactaaaacgggtagaacggcaagattgatctccagattt
aagccaaagcagtggatacttgcattctctacgagggagaaagtttgcaataacctaatg
ttcagctatggagtgtatccattctgtatggaggaagggttcaatgagaatgacattgtt
aggttaataaagggactaggattggttggaagcgatgacatagttttgatgacggaaggt
aagccgatagagaaaaccgttgggactaattcaataaagatattccaaatagcgtga

DBGET integrated database retrieval system