KEGG   Pyrococcus horikoshii: PH0570Help
Entry
PH0570            CDS       T00014                                 

Gene name
PH0570
Definition
(GenBank) 478aa long hypothetical pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
pho  Pyrococcus horikoshii
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PH0570 (PH0570)
   01230 Biosynthesis of amino acids
    PH0570 (PH0570)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PH0570 (PH0570)
   00620 Pyruvate metabolism
    PH0570 (PH0570)
  Nucleotide metabolism
   00230 Purine metabolism
    PH0570 (PH0570)
Enzymes [BR:pho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     PH0570 (PH0570)
Exosome [BR:pho04147]
 Exosomal proteins
  Proteins found in most exosomes
   PH0570 (PH0570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(508785..510221)
Genome map
AA seq 478 aa AA seqDB search
MRRMKLPSHKTKIVATIGPATNSKKMIKKLIEAGMNVARINFSHGTFEEHAKIIEMVREQ
SQKLDRRVAILADLPGLKIRVGEIKGGYVELERGEKVTLTTKDIEGDETTIPVEYKDFPK
LVSKGDVIYLSDGYIVLRVEDVKENEVEAVVISGGKLFSRKGINIPKAYLPVEAITPRDI
EIMKFAIEHGVDAIGLSFVGNVYDVLKAKSFLERNGAGDTFVIAKIERPDAVRNFNEILN
AADGIMIARGDLGVEMPIEQLPILQKRLIRKANMEGKPVITATQMLVSMTMEKVPTRAEV
TDVANAILDGTDAVMLSEETAVGKFPIEAVEMMARIAKVTEEYRESFGITRMREFLEGTK
RGTIKEAITRSIIDAICTIGIKFILTPTKTGRTARLISRFKPKQWILAFSTREKVCNNLM
FSYGVYPFCMEEGFNENDIVRLIKGLGLVGSDDIVLMTEGKPIEKTVGTNSIKIFQIA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggatgaagcttccctcccataaaacaaagattgtcgcaacgatagggccggca
actaactcgaaaaaaatgatcaaaaaattaattgaagctggcatgaacgttgcaagaata
aacttttctcatggcacattcgaagagcatgcaaagatcatagagatggtgagggaacag
tcacagaagttagataggagagttgcaatattagccgaccttcccggactgaagattagg
gttggggagataaaggggggatatgtggaacttgaaagaggggagaaagttactttgaca
acaaaagatattgagggagatgaaacaacgatccccgtagaatataaggatttcccaaag
cttgtatctaagggagatgtgatatacctaagcgatggctatatagtgttaagagtcgaa
gatgtaaaggagaatgaagttgaagcagtagttatttctggtggaaaactcttctcgagg
aaagggataaacattccaaaggcctatcttcccgttgaagctataactccaagagatata
gagataatgaagttcgcaatcgaacatggcgtcgatgcaataggactcagctttgttgga
aacgtttacgatgtactaaaagcgaagagctttttggagagaaatggcgcaggtgacacc
ttcgttatagctaagatcgaaagacccgatgctgttagaaacttcaatgaaattctaaat
gccgctgacgggattatgatagccaggggtgatctaggggttgagatgccaatagaacaa
cttccaattctccagaagaggttaattaggaaagccaacatggaaggaaagcctgtaatt
acggcaacccagatgctcgtttccatgacaatggaaaaagtcccaacaagagctgaagtt
acagacgttgccaatgcaatactagatggaaccgatgccgttatgttgtctgaagaaaca
gcagttggaaaattcccgattgaggccgtcgagatgatggcaaggatagcgaaagtaact
gaggaatatagggaaagctttgggataaccagaatgcgagagttcctggaaggaacgaag
aggggaacgataaaggaggcgataaccaggagtatcattgatgccatctgcactataggt
ataaagttcatattgacgccaactaaaacgggtagaacggcaagattgatctccagattt
aagccaaagcagtggatacttgcattctctacgagggagaaagtttgcaataacctaatg
ttcagctatggagtgtatccattctgtatggaggaagggttcaatgagaatgacattgtt
aggttaataaagggactaggattggttggaagcgatgacatagttttgatgacggaaggt
aagccgatagagaaaaccgttgggactaattcaataaagatattccaaatagcgtga

DBGET integrated database retrieval system