KEGG   Paraburkholderia hospita: C2L64_21710Help
Entry
C2L64_21710       CDS       T05305                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
phs  Paraburkholderia hospita
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:phs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2L64_21710
  Energy metabolism
   00680 Methane metabolism
    C2L64_21710
Enzymes [BR:phs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C2L64_21710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(731182..734100)
Genome map
AA seq 972 aa AA seqDB search
MSRAALPDWGYGPEPQPDPPRVEVVRPFPASRHADAEVGGLHELAIASAALPALSAEDYE
YAVIELLSELLRDIARSRQPEVERTLMGESAHESMTELMRERMDDRTARVILRRMLQAQG
MWFQLLSIAEQSTAMRRRREIEIEGGYDWLPDSFARVIAEAAEAGIPAAEVRDALSQMKV
RPVLTAHPTEAKRVTVLEIHRRIYRRLMELESPRWTPRERHTLILALRNDIELLWMSGEL
RLEKPTVAQEVAWGLHFFSETLFEAVPLLFDKLESALARHYPGERFDMPRFFQFGSWIGG
DRDGNPFVDDSVTRATLHENRLACLKRYRLRLVELTQMLSITSEALPVPDSFHEALARAL
MRSGEATSVASRNPGELFRQYLTCILRRLDGSLANASRPADGTPVQGGYTSADELAADLL
VIEQTLFATGSAQLAHMLVRPLRQEVETFRFSTVQLDLRQNTTVIEQALRALWRATCGTS
GEPPASDSPEWKAWLLSELAQPSDSEQERERRFDSLPFDEAQTLQIFRTAREMRQQVDRN
AFGAFILSMTHRASDVLGVYLLAKEAGLFSDAAGTESCTLPVVPLLETIDDLRRAPEILR
ELLAVPMVRRSIRAQGGVQEIMIGYSDSNKDGGFFASNWELSKAQTKIKRLGDELGVTIA
FFHGRGGSVSRGGIPAGRAVAALPAGSVKGRFRVTEQGEVVSFKYANRGTAQYHVELLAS
SVLEHTLKSEREEALLPKGEFDEAMEALSGASRAAYAKFIEQPGMLAYFQAASPLEELSM
LNMGSRPARRFGATSLQDLRAIPWVFAWSQNRHALTGWYGVGSAIEGFLSVRQERGIDLL
RRMFDESRLFRLVIDEVEKTLAQVNLDIAREYASLVPDEAIRDTIFAQIEAEFRLTVKMV
QTLTGSSGLGTRFPKFHARLQRRLPAIDLVSRQQIELLRLYRSSQTERQRRAYQVPLLLS
INCIASGFGATG
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgccgcgttgcctgattggggctacggcccagaaccacaacccgacccgccg
cgcgtcgaggttgtgcgccccttccccgcgagcaggcacgccgacgctgaagttggcggg
ctgcacgagctcgcgatcgcgtcggctgccctgcccgcgctcagcgcggaagattacgaa
tacgctgtcatcgagttgctttcagaactgttgcgcgacattgcgcgcagccgccagccg
gaggttgaacgcacgctgatgggcgagtcggcgcatgaatcgatgacggaactgatgcgc
gagcggatggatgatcgtaccgcgcgcgtcatcctgaggcgcatgctgcaggcgcaaggc
atgtggttccagctgctcagcatcgccgagcagagtaccgcgatgcgccgccgccgggag
atcgagatcgaaggcggctacgactggttgcccgattcgtttgcgcgggtgattgccgaa
gcggccgaggcgggcattcctgccgccgaagtgcgtgacgcgctgagtcagatgaaggtg
cgccccgtactgacggcccacccaacggaagccaagcgtgtcacggtgctcgaaatccat
cggcgcatctaccggcgtctgatggaactcgaatcgccgcgctggacaccgcgcgaacgc
cacacgctcatcctcgcgctcaggaacgatatcgagctgttgtggatgagcggcgagctg
cggctcgaaaaacccacggtcgcacaggaagtcgcgtggggtctgcactttttcagcgag
acgctgttcgaagccgtgccactgctgttcgacaagctggagagcgcgctcgcgcgtcac
tatccgggcgagcgcttcgacatgccgcgttttttccagtttggttcgtggataggcgga
gaccgcgacggcaatcccttcgtcgacgacagcgtcacgcgcgccacgctgcatgagaac
cggcttgcgtgcctgaagcgctaccggctgcgtctcgtcgaactgacgcagatgctgagt
atcacgtccgaggcattgcctgtgccggacagtttccacgaagcgctggcgcgcgcgctg
atgcgcagcggcgaggccacgtcggtcgcgtcgcgcaatccgggcgaactgttccgtcaa
tacctgacgtgcatcttgcgccggctcgacgggtcgcttgccaacgcaagccggcccgcc
gacggcacgcccgttcaaggtggctacacgagcgccgacgagcttgccgctgatctgctg
gtgatcgagcagacgctctttgcgacgggcagcgcgcaactggcgcatatgctcgtacga
ccgttgcggcaagaagtggagacgtttcgcttcagcaccgtgcagctcgacctgcgtcag
aacacgacggtgatcgagcaggcgctgcgcgcgttgtggcgcgcgacctgtggcacatcc
ggcgagccgcccgccagcgactcgcccgaatggaaagcgtggctgctcagcgaactggcc
caaccctcggacagcgagcaggagcgggaacgccgcttcgattcgctgccattcgacgag
gcacagacgctgcagattttccgcacggcgcgcgagatgcgccagcaggtggatcgcaat
gcattcggcgcgttcattctgagcatgacgcatcgggcgagcgatgtgctcggggtctat
ctgcttgccaaggaggccggtctcttttccgacgcagccgggacggaaagctgcacgtta
cccgtcgtgcccctgctcgaaaccatcgacgacttgcgccgcgcgcccgaaatcctgcgc
gaactgctggccgtgccgatggtccgccgcagcattcgcgcacagggcggcgtgcaggaa
atcatgatcggctattcggattcgaacaaggacggcggatttttcgcgagcaactgggaa
ttgtcgaaagcgcagacgaagatcaagcggctcggcgatgaactgggcgtcacgatcgcg
ttcttccacggacgcggcgggtcggtgagccggggcggcataccggctggccgcgccgtc
gccgctttgcccgccggctcggtcaaaggacgttttcgcgtgaccgaacagggcgaagtg
gtgtcgttcaaatacgcgaatcgcggcacggcgcagtatcacgtcgagttgcttgcgtcg
agcgtactcgaacatacgctgaagtcggagcgcgaagaagcgttgctgccgaagggcgaa
ttcgatgaagccatggaagcgctctcgggcgcgtcgcgggccgcgtatgcgaagttcatc
gagcagccgggcatgctcgcgtatttccaggcggccagcccgctcgaagaactgtcgatg
ctcaacatgggctcgcgccctgcccgccgcttcggcgcaacgagcttgcaggatctgcgc
gcgattccgtgggtgttcgcatggtcgcagaaccggcacgcgctgacgggctggtacggc
gtgggcagcgcgatcgaaggcttcctttcggtgcggcaggaacgcgggatcgacctgctg
cggcgaatgttcgacgaatcgcggctgttccggctcgtcatcgacgaggtcgaaaagacg
ctggcccaggtcaatctcgacattgcacgcgagtacgcgagcctcgtgcccgatgaagcg
atccgcgacacgatcttcgcgcagatcgaagccgaattcaggctcacggtgaagatggtg
caaacgctcacgggctcgtccggactgggcacccgctttccgaagttccatgcgcgtctg
cagcgccgtttgcccgctatcgatctcgttagccgccagcagatcgaactgctacgtctc
taccgttcgtcacaaacggaacgacagcggcgcgcgtatcaggtgccgctgctgctgtcc
atcaactgcatcgcatcgggcttcggcgcgacgggctag

DBGET integrated database retrieval system