KEGG   Phyllobacterium sp. Tri-48: BLM14_19210Help
Entry
BLM14_19210       CDS       T05167                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pht  Phyllobacterium sp. Tri-48
Pathway
pht00020  Citrate cycle (TCA cycle)
pht00310  Lysine degradation
pht00380  Tryptophan metabolism
pht01100  Metabolic pathways
pht01110  Biosynthesis of secondary metabolites
pht01120  Microbial metabolism in diverse environments
pht01130  Biosynthesis of antibiotics
pht01200  Carbon metabolism
Module
pht_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pht_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pht00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLM14_19210
  Amino acid metabolism
   00310 Lysine degradation
    BLM14_19210
   00380 Tryptophan metabolism
    BLM14_19210
Enzymes [BR:pht01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BLM14_19210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ATU93498
UniProt: A0A2D3IIQ5
LinkDB All DBs
Position
3901020..3904037
Genome map
AA seq 1005 aa AA seqDB search
MARQEQANDIFALTSFLYGGNAHYIEELHAQYEKDPASVGTEWQEFFANLNDTKDDVLKN
AKGASWEKPNWPIAGNGELVSALDGNWGEVEKHITDKLKAKGANGSAATNGVAAPLTPAS
DSDIIHAARDSVRAIMMIRAYRMRGHLHAKLDPLGLAEVKEDYNELSPESYGFTAADFDR
KIFIDNVLGLEYATIPQMLEILKRTYCSTIGVEFMHISDPVEKAWIQERIEGPDKGVAFT
AEGKRAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGSMGLKEIVL
GMAHRGRLNVLSQFMRKPHRAIFHEFKGGSYTPDDVEGSGDVKYHLGASSDREFDGNKVH
LSLTANPSHLEIVNPVVMGKARAKQDLLCGRDRDEIVPLSERSKVMPLLLHGDAAFAGQG
VVAECLGLSGLRGHRVAGTVHFIINNQIGFTTNPRFSRSSPYPSDVAKMIEAPIFHVNGD
DPEAVVYVAKIATEYRMTFHKPVVIDMFCYRRFGHNEGDEPAFTQPIMYKTIRSQKTTVQ
LYSAKLIEEGLITEADLEKMRAAWRENLEQEFEAGQAYKPNKADWLDGAWSGLRTADNAD
EQRRGKTGLPVKTLKEIGKKLAEVPAGLNVHRTIQRFQDNRAKMIETGEGFDWATAEALA
FGSLVTEGHPVRLSGQDVERGTFSQRHSVLYDQDTEQRYIPLNNLQKGQALYEVINSMLS
EEAVLGFEYGYSLSDPRALTLWEAQFGDFANGAQVIFDQFISSGERKWLRMSGLVCLLPH
GYEGQGPEHSSARLERYLQLCAEDNMQVANCTTPANYFHILRRQMKRDFRKPLILMTPKS
LLRHKRAVSSIGDFTGDSSFHRLLWDDAQLLKDQPIKLQKDSKIRRVVLCSGKVYYDLYE
EREKRGIDDVYLLRVEQLYPFPAKALITELSRFRNAEMVWCQEEPKNMGAWAFIDPYLEW
VLAHIDAKHQRVRYTGRPAAASTATGLMSKHLAQLEALLEDALGS
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcaagaacaggccaacgacattttcgcgctcacctcgtttctttatggtggc
aatgcccactatatcgaggaactgcacgcgcaatatgagaaggatccggcatcggttggt
accgaatggcaggaattcttcgccaacctcaacgataccaaggacgatgttctcaagaac
gccaagggcgcatcctgggaaaagccgaactggccgatcgccggcaatggcgaactcgta
tcggcgctcgacggcaactggggcgaagtcgaaaagcacatcaccgacaagctgaaggcc
aagggcgcgaatggttctgcggcaaccaatggagttgccgcacctctgacgccggcatcc
gactcggacatcattcatgcggcccgcgattccgtgcgcgcaatcatgatgatccgcgcc
tatcgcatgcgcggccatttgcatgccaagctcgacccgcttggccttgccgaagtcaag
gaagactacaacgagctgtcgcctgagagctatggtttcacggcggccgatttcgaccgc
aagattttcatcgataatgtgctgggtctcgaatatgcgacgatcccacagatgctcgag
atccttaagcgcacctattgctcgaccattggtgtcgaattcatgcatatttccgatccg
gtggaaaaggcctggatccaggaacgcatcgaaggcccggacaagggcgtcgccttcacc
gctgaaggcaagagggcgatcctgtcgaagctgattgaggccgaaggtttcgagcaattc
atcgacgtcaagtacaagggtaccaagcgcttcggcctggatggcggcgagtcgctcatt
ccggcgctggaacagatcgtcaagcgtggcgggtccatgggcctgaaggaaatcgtcctc
ggcatggcgcatcgtggccgcctcaacgtgctcagccagttcatgcgcaagccgcaccgt
gccattttccatgaattcaagggtggttcctacacgccggacgatgtcgaaggttccggc
gacgtgaagtaccatctaggagcctcgtcggaccgcgagttcgatggcaacaaggtccat
ctctcgctgacggccaacccctcgcacctcgaaatcgtcaatccggtagtcatgggcaag
gcacgcgccaagcaggacctgctctgcggccgcgaccgtgacgaaatcgtgccgctgtcc
gagcgttcgaaggtcatgccgctgcttctgcatggcgacgcagccttcgccggccagggc
gtggttgccgagtgcctcggcctttccggcctgcgcgggcatcgcgttgccggtacggtg
cattttatcatcaacaaccagatcggctttaccaccaatccgcgtttctcgcgctcctcg
ccatatccttccgatgttgcgaagatgatcgaagcgccgatcttccacgtcaatggcgac
gatccggaagctgtggtctatgtggcgaagatcgccaccgaatatcgtatgacgttccac
aagccggttgtcatcgacatgttctgctatcgccgcttcggccataacgaaggcgacgag
ccggcgttcacgcagccgatcatgtacaagacgatccgcagccagaagacgacggttcag
ctctattcggcgaagctgatcgaggagggcctgattaccgaggccgatctcgagaagatg
cgtgccgcatggcgcgaaaatctcgagcaggagttcgaggctggccaggcgtacaagcca
aacaaggccgactggctcgacggtgcctggagtggcctgcgtacggcagataatgccgat
gagcagcgccgcggcaagactgggctgccggtgaagacgctcaaggaaatcggcaagaag
cttgccgaagtcccggccggtctcaacgtgcaccggacgatccagcgcttccaggacaac
cgcgccaagatgatcgaaactggagaaggcttcgactgggcaacagcggaggctctggcg
ttcggttcgctggtgacggaaggccatccggtacgcctgtcgggtcaggatgtcgagcgt
ggtacattcagccagcggcattcggtgctctacgatcaggacaccgaacagcgctacatc
ccgctcaataatctgcagaagggtcaggcgctctacgaagtcatcaattcgatgctttcg
gaagaagcggttctcggcttcgaatatggctattcgctgtcggatccacgtgccctgact
ctgtgggaagcgcagttcggcgacttcgccaatggtgcacaggtcatcttcgaccagttc
atctcgtcgggcgagcgcaaatggctgcgcatgtcgggtctcgtctgcctgttgccacat
ggctatgaggggcaggggccggaacattcgtcggcccgcctcgaacgctatctccagctc
tgtgcggaagacaatatgcaggttgcaaactgcacgacgcctgcgaattacttccatatc
ctgcgccgtcagatgaagcgcgacttccgcaagccgctgatcctgatgacgccgaagtcg
ctgctgcgtcacaagcgggcggtctcgtcgatcggcgacttcaccggggattcgtccttc
catcgcctgctgtgggacgacgcgcagctgctcaaggatcagccgatcaagctgcagaag
gactcaaagatccgccgcgtagtcctgtgctccggcaaggtctattacgatctttacgaa
gagcgcgaaaagcgcgggattgacgacgtctatctcctgcgcgtcgagcagctttatcca
ttccctgcaaaggccctgatcaccgagctttcccgcttccgcaatgcggaaatggtctgg
tgtcaggaagaacccaagaacatgggtgcctgggcctttatcgatccctatctggaatgg
gttctggcgcatatcgatgccaagcatcagcgcgttcgttataccggacgtcctgctgct
gcatcgactgcaactggcttgatgtccaaacaccttgcacagctcgaagcattgcttgaa
gatgctttgggttcttaa

DBGET integrated database retrieval system