KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM233600Help
Entry
Phum_PHUM233600   CDS       T01223                                 

Definition
(RefSeq) aldehyde dehydrogenase, putative
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
phu00010  Glycolysis / Gluconeogenesis
phu00053  Ascorbate and aldarate metabolism
phu00071  Fatty acid degradation
phu00260  Glycine, serine and threonine metabolism
phu00280  Valine, leucine and isoleucine degradation
phu00310  Lysine degradation
phu00330  Arginine and proline metabolism
phu00340  Histidine metabolism
phu00380  Tryptophan metabolism
phu00410  beta-Alanine metabolism
phu00561  Glycerolipid metabolism
phu00620  Pyruvate metabolism
phu01100  Metabolic pathways
Module
phu_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phum_PHUM233600
   00053 Ascorbate and aldarate metabolism
    Phum_PHUM233600
   00620 Pyruvate metabolism
    Phum_PHUM233600
  Lipid metabolism
   00071 Fatty acid degradation
    Phum_PHUM233600
   00561 Glycerolipid metabolism
    Phum_PHUM233600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Phum_PHUM233600
   00280 Valine, leucine and isoleucine degradation
    Phum_PHUM233600
   00310 Lysine degradation
    Phum_PHUM233600
   00330 Arginine and proline metabolism
    Phum_PHUM233600
   00340 Histidine metabolism
    Phum_PHUM233600
   00380 Tryptophan metabolism
    Phum_PHUM233600
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Phum_PHUM233600
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Phum_PHUM233600
    1.2.1.8  betaine-aldehyde dehydrogenase
     Phum_PHUM233600
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     Phum_PHUM233600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 8230175
NCBI-ProteinID: XP_002426046
VectorBase: PHUM233600
UniProt: E0VIV2
LinkDB All DBs
AA seq 534 aa AA seqDB search
MLTCVLRVVKNKKANIFFGCRKMSLLIDNPQYDFLKTLGLEKRNKGVYNGKWFGSGEVVT
SYSPSSGAPIAEVVKGTQEDYESCVEECKKAFKTWAGLPAPKRGEIVRQMGDALRQKKEP
LGKLVSLEMGKIFAEGVGEVQEFVDICDYATGLSRTFGGPILPSERPGHVLLEVWNPLGV
VGVISAFNFPVAVYGWNAAIALVCGNTVLWKGASTTTLISIATTKIIAKVLEDNGIPGAV
ASMICGGPAVGEAMAKDQRVELVSFTGSTPIGQKVGVLVQERFGRSILELGGNNALIVNE
DADLDMVIRSSVFACVGTAGQRCTSLRRLIIHEKVYDEVLQKLKQIYKQIMNRVGDPLDT
KTLLGPLHTKAAVAEYEETIKEVKKLGGTIEIGGKAMSRSGFFVEPTIVTGLKSDNPMVR
KETFAPIVYLLKTKSLEEAIEINNSVEQGLSSSLFTKDLGCIFQWLGPFGSDCGIVNINI
PTSGAEIGGAFGGEKGTGGGRESGSDSWKQYMRRATVTVNYSKDLPLAQGITFE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgtgtgtgctgagagttgttaaaaataaaaaggccaatatattttttggatgt
agaaaaatgtctttgttaatcgataatccacaatatgattttttaaaaactctcggattg
gaaaaaaggaataagggggtctacaatggaaaatggttcggtagcggagaagtcgttact
tcgtacagtccatcaagtggtgcaccaattgccgaagttgtcaaaggtacacaggaagat
tacgaaagttgcgttgaagaatgtaaaaaagcatttaaaacatgggctggtttaccggca
cccaaaagaggagaaattgttcgacaaatgggtgatgctcttagacaaaaaaaagaacct
ttgggaaaattggtatcacttgaaatgggaaaaatatttgccgaaggagtaggagaggtt
caagaatttgtagatatttgtgattatgcaacagggttatcgagaacatttgggggaccc
attcttccatcggaaagaccaggtcatgttcttttagaagtttggaatccacttggtgtc
gttggtgttatttcggcttttaattttcccgttgccgtttacggatggaatgctgcaata
gccctggtgtgcggtaacacagttttatggaaaggagcatcaacaactactttaatttca
attgctacgactaaaataatagctaaagttttagaagataatggaataccaggagctgtg
gcttcgatgatttgtggaggacctgctgtcggagaagcaatggctaaagatcaaagagtt
gaattagtttcatttaccggaagcacgccaataggacaaaaagttggagttttagttcaa
gaaaggtttggaagatccatattagaattgggaggaaacaatgcattaattgtaaatgaa
gatgctgatttagatatggtgatacgctcatccgtttttgcttgtgtgggtacggctgga
caaagatgtacgtctttaagaagattaatcattcacgaaaaggtgtacgatgaagtttta
caaaaattaaaacaaatatataaacaaataatgaatcgtgtcggagatccgcttgacacc
aaaactctacttggacctctgcacactaaagccgctgttgcagaatatgaagaaaccata
aaagaagtcaaaaaattaggtggaaccatcgaaataggtggaaaggcaatgtcaagaagt
ggattttttgtagagccaaccatagtcacaggtttgaaaagtgataatccaatggttaga
aaagaaacatttgccccaattgtatatttattaaagacaaaatcattagaagaagcaatt
gaaataaataattcggtcgaacaaggtctttcttcaagtttatttacaaaagatttaggt
tgcattttccaatggttgggtcccttcggttcggattgcggtattgttaatataaacatt
ccaacgagtggagccgaaataggtggagcattcggtggagaaaaaggtacaggtggagga
cgagaatcaggttccgattcatggaaacaatacatgagacgtgcaacagtcacggttaat
tacagtaaagatttgccattggcacaaggaattacttttgagtaa

DBGET integrated database retrieval system