KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM292420Help
Entry
Phum_PHUM292420   CDS       T01223                                 

Definition
(RefSeq) histone deacetylase 7A, putative
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
phu  Pediculus humanus corporis (human body louse)
Brite
Enzymes [BR:phu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Phum_PHUM292420
Chromosome [BR:phu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     Phum_PHUM292420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 1002 aa AA seqDB search
MKRNTVAKSPILSRQNDVNHTYPGDPGLHAQAFQQQLLQLKKQQQLQQQILLQHYQTQQQ
QLAEQHEQQLRHHLKEFREQQKALEEQKERREKEKLEALKRKDKHEQSAVASSEVKQRLQ
GFLLNKKQREAAANGTSGPLPGSASFNRSQQWGEPPSSTPSGAGAPHPYHLNHLVAAKYD
EDFPLRKTASEPNLLKVRLKQRVIERRASPMARRNQRLISTLKKKSVLVNAANNSTETTS
SNSPPVVTNLRTSPSAAGSTPIREEPESPTYGQLSNSSQQGSMSDLSLYSSPSMPNISLG
RPPSSHNSGHENKLASVSEAEVRAAFTARLGMPLTGQMLPGTLPFYPTLPAIDSEPTDSA
AVHKQMETLEQSGNPTVSGYQQMTDSQVAHARLTKHGHRPLGRTQSAPLPLGHPMLASHN
VLTIPQRYEDQRTQHNLLKQQIRQTVLTRAGRQLEDQPEVVDETAEVIDLTDQRLEVDED
QNECEMSRQQKDREQFLQQQRDLMMRHNLQANEGSTFVPRNTSYVARPLSRALSSPLVAL
GGSDIPLSPVNCHSSHVPKLNSSVHCITTGLAFDNLMLKHACVCGDNSSHPEHGGRLQSV
WARLLETGLVARCDRLRARKATIEEIQSCHSEAHALLFGTNPLNRQKLDINKIAALPIKC
FVRLPCGGVGVDSDTTWNELHTAPAARMAVGCVVDLAMKTAMGDMKNGFAVVRPPGHHAE
NSQAMGFCFFNSVAIAAKLLQQRLRVRKILIFDWDVHHGNGTQQMFYDDPHVLYLSVHRH
DDGNFFPGTGGPTECGTGEGLGYNVNIAFSGGLQPPMGDAEYLAAFRTIVMPIAKKFDPD
IVLVSAGFDAAAGHPPPLGGYKVSASCFGHMTQELLNLADGKVVLALEGGYDLPSICDAA
QECVRALLGDDPTPISEEELTRPPCQAAVDTMQKTIAIQLTHWPCLKKLAHTVGLPYAEK
EKEDSDTITRMAGLSMQQNQYLQSPERTHRDSEEPMEEDEGK
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacacggttgcaaaatctccaatattatctcgacaaaatgatgtcaatcac
acttatccgggggatccagggcttcacgctcaagcttttcaacagcaactccttcaattg
aaaaagcaacaacaattacaacagcaaattttattgcaacactatcagacgcaacagcaa
caattagcggaacaacatgaacaacagttacgacatcacttgaaggaatttcgagagcaa
cagaaagctctagaagaacaaaaggaaagaagggaaaaggaaaaattggaagctttaaaa
agaaaagacaagcatgaacaaagtgccgtcgctagcagtgaagttaaacaaagattacag
ggatttcttcttaataaaaaacaacgagaagcagcagcgaacggaacgtcgggtccttta
ccaggttccgctagctttaacaggagccaacaatggggtgaacctcccagttcaacaccg
tcaggagcaggagcacctcatccctaccaccttaaccatctcgtggcagccaaatacgat
gaagattttccgcttagaaagacagcctcggagccgaatctgctcaaagtgaggctaaag
caacgggtaattgaaaggagagcctcaccaatggccagaagaaatcaaaggttgatatcg
acactcaagaaaaaatctgtacttgttaatgccgccaataacagtacggaaacgacttct
tctaattctcctcctgttgtgaccaatttaagaacgtctccttcggcagcagggagtact
cctatcagagaggaacccgagtctcctacttacggccaattaagtaattcatctcaacaa
ggctccatgtctgatttatcactgtacagcagtccgtccatgcctaatatatcgctagga
cgtcccccctcatctcataattccggacacgaaaataaattagcatccgtttccgaagca
gaagttcgtgctgcttttacagcaagattaggaatgcctttaactggacaaatgctcccc
ggaacgcttccgttctatcctactttgcctgctattgacagtgaacctactgatagcgct
gccgttcataagcaaatggaaacattagaacaatctggaaatcctacagtttccgggtat
cagcaaatgaccgacagtcaagttgctcacgctcgtcttactaaacacggtcatagacct
ttaggaagaactcaatctgcacccttacccttgggtcatccaatgttggcatctcataat
gttctcaccattcctcaacgttatgaagatcaaagaactcaacataatttgcttaaacaa
caaatccgtcaaacagttttaacgcgagccggaagacaattggaagaccaaccggaagtg
gttgatgaaacggctgaagttatcgatctcacagatcagagattagaagttgatgaagat
caaaacgagtgcgaaatgtctcggcagcaaaaagatagagaacaatttttgcaacagcaa
agagatttaatgatgagacataatctgcaagcgaacgaaggatcaacttttgttccgaga
aatacttcttacgttgctcgacctttatctagagcactttccagcccattagtcgctttg
ggaggttcagacattcctttatcgccagtaaactgtcattcttctcacgtacctaaatta
aatagcagtgttcattgtattacaacgggtttagcttttgacaatctcatgttgaagcat
gcttgtgtttgcggggacaattcttctcatcccgaacacggtggtagattgcaaagcgtt
tgggcgagattactcgaaacaggtttagtcgctagatgtgataggcttagagccaggaaa
gcaacgatagaagaaattcaaagttgtcatagcgaagctcacgctttgctttttggtaca
aatcctttaaatagacagaaattagatataaataaaatagctgctttgccaatcaagtgt
ttcgttcgactcccttgcggtggagtcggtgtagattcggatacaacgtggaatgaattg
catacagcacctgctgccagaatggctgttggctgcgtcgtggatttggcaatgaagact
gcaatgggagatatgaaaaatggatttgctgtcgttagacctcccggtcatcatgcagaa
aattctcaagccatgggattttgctttttcaattctgtcgcaatagcagcaaaactttta
cagcaaagactaagagttagaaaaatattaatttttgattgggacgtacatcacggaaac
ggaactcaacaaatgttttacgacgaccctcacgttttatatttatccgtacatcgacac
gatgacgggaattttttccccggaactgggggtcctaccgaatgtggaacaggagagggt
ctcggttacaacgtcaacattgctttttccggtggtttgcaaccacccatgggagatgcg
gaatatttggcagcttttagaactatcgtcatgccgattgcaaaaaaatttgatcctgat
attgttttggtatcggcgggtttcgatgctgccgccggtcatccgccacctcttggaggt
tataaagtctcggcgtcttgttttggtcacatgacccaagaattgttaaatttagccgat
ggaaaagtcgttttggctttggaaggagggtatgatctgccatctatttgtgatgccgct
caggaatgtgtgagagctttattgggtgatgatcccacccccatttccgaagaagaacta
actagaccaccttgtcaggctgctgttgatacgatgcaaaaaactatagccatacaattg
acgcattggccatgtttgaaaaaattggcgcacacggtcggattgccttatgccgaaaag
gaaaaagaagatagtgacacgatcacgcgcatggccggtttatcgatgcaacaaaatcaa
tatttgcaatctccagagcgcactcatcgtgattctgaagaacccatggaagaagatgag
ggtaaatga

DBGET integrated database retrieval system