KEGG   Pediculus humanus corporis (human body louse): Phum_PHUM600380Help
Entry
Phum_PHUM600380   CDS       T01223                                 

Definition
(RefSeq) superoxide dismutase, putative
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
phu  Pediculus humanus corporis (human body louse)
Pathway
Peroxisome
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:phu00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Phum_PHUM600380
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Phum_PHUM600380
Enzymes [BR:phu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Phum_PHUM600380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 154 aa AA seqDB search
MAAKAVCVLTGDKVKGVINFSQQSPTDPVVISGEVSGLTEGKHGFHVHEFGDNTNGCTSA
GAHFNPFNRDHGGPDAAVRHVGDMGNIVANNQGVATVKLSDTVMSLSGQTSIIGRTVVVH
ADPDDLGLGGHELSKTTGNAGGRVACGVIGIAKV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaagcagtttgcgttttaactggagacaaagttaaaggagttattaatttt
tctcaacaaagcccaaccgatccagttgtaatttcgggagaagtctcaggattaaccgag
ggcaagcatggatttcacgttcatgaattcggagacaacaccaacggttgcaccagtgca
ggtgcccattttaatccattcaatagagatcacggaggtccagatgctgctgtaaggcat
gttggagatatgggtaatattgtggcaaacaatcaaggagtagctactgtgaaactgagt
gatacagttatgtcactttctggacaaaccagcattattggcagaactgttgttgttcac
gcagacccagatgacttgggactcggtggtcatgaacttagtaaaactaccggtaatgct
ggtggaagagttgcttgtggggtcataggtattgctaaggtatga

DBGET integrated database retrieval system