KEGG   Paenibacillus ihbetae: BBD41_00040Help
Entry
BBD41_00040       CDS       T05154                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pib  Paenibacillus ihbetae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pib00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBD41_00040
Enzymes [BR:pib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBD41_00040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7929..9914
Genome map
AA seq 661 aa AA seqDB search
MRMGVDYYPEHWDRSMWEEDAKLMQETGVSLIRVAEFAWSRLEPTEGNYDFTWLDDAIDT
FATHGIQVVIGTPTCTPPNWLVNAYPDVLPQDEKLHPRYPGIRGHRCYNSPSMRHYSALI
VERLALHYANNPAVIGWQTDNEFSLNECNCEHCNSRFRMWLQDKYDSIESINAAWGTVVW
SGEYSDWSQITTPLGGTNHKNPSYVLDYKRFETDSVVEFQQLQLNILRKHCPNHFVTHNI
WSYPMSLDYYKLCENLDFVSLDYYPSTSPEKAESSGYSGALTLDLARGIKRQNFWIMETI
SGPPGCWMPMWRTPHPGFIRAFAWQSIARGAGTLVHFRWRSAPSGAEQFWHGLIDHSNVP
GRRFEEYRGLCDEVRKLAPLLEGTEVQGEVAILHSHDQYNAFQIQHQVEGMDYFDNLKTI
HRAFTKLGIMTDVLNETDDLSGYKLIVAPSLFLLDPEIASRLETCVKNGATLVLMPRTGV
KNQNNVCWIQPLPGPLSNAAGVTVAEYDPIGRDVHNIRWQNKAYSCSQWCDILSPKGAEA
VAWYEDDFFAGETAATVHKFGEGKVYYLGTVPEEAFYLDFFRDVADNSGLHFIPDLPEGI
QISTRVKGSTRYLFLMNLTRKQQTMLLDGTFRSLLGSREIGPALTMAPYAVEIVELPQKN
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgggtgtggattactatccggagcattgggaccgctctatgtgggaagaagat
gctaagctcatgcaagagacaggcgtaagtttgattcgggtagccgaattcgcctggtca
cgacttgaaccgactgaaggcaactatgatttcacttggcttgatgatgcaatagatacg
tttgcaacacatggtatccaagtggtcatcggaacgccgacctgcacgccgccgaattgg
ctcgtgaatgcgtatcccgatgtgctaccacaagacgaaaagctgcatccacgttatccg
ggaattcgggggcaccgttgttataacagtccttccatgagacactattcggcattaatt
gtggaaaggcttgctcttcactatgcgaataatccagctgttattggttggcagactgat
aatgagtttagtctgaatgaatgcaactgcgagcattgcaattcgcggttccggatgtgg
cttcaggataagtatgattcgatcgaatccatcaacgcggcgtggggtaccgtcgtgtgg
agcggggagtacagcgattggtcgcaaataacaactccgcttgggggaaccaatcataag
aacccatcctatgtattggattacaaacgtttcgagactgattccgtagtcgaattccaa
cagctgcaattgaacattttgaggaagcattgtccaaatcattttgttacgcataacatc
tggagttatccgatgtcgctggattattacaaactttgcgagaatctagatttcgtttct
ctcgactattacccgagcacaagtccggagaaagcggagtcgagcggatacagcggagca
cttacattggatttagcccgtggaattaaacggcagaatttctggatcatggagacaatt
agtggcccgccggggtgctggatgccgatgtggcgtacgcctcatcctggatttatccgt
gcctttgcttggcagagcatcgcacgtggcgcaggtacactcgtacacttccgttggcga
agcgctccatctggagcagagcaattctggcacgggcttatcgatcacagtaacgtgccc
ggcaggagattcgaggaataccgcgggttgtgcgatgaagtccggaagcttgctccgctg
ttggaagggacggaagtgcagggcgaagtggccattcttcattcgcacgatcaatataac
gcgtttcagattcaacaccaggtagaaggtatggattatttcgataatctgaaaacgatc
catcgtgccttcactaagctcggcatcatgacggatgtactaaacgagacagatgatctg
agcggatataagttaattgtggctccttcgctcttcctgctcgacccagagattgcgtct
cgtttagagacttgcgtcaagaacggagctacgctggtattgatgcctcgaacgggcgtg
aagaaccagaataacgtatgctggatccaaccgttgcccggaccgctttccaatgcggcg
ggggtcactgtagctgagtatgacccgatagggagggatgtacacaacatccgctggcag
aataaagcttactcctgcagccaatggtgcgatatcctatcacctaaaggtgctgaggca
gtggcatggtatgaagacgatttcttcgcaggtgagacagccgcgactgttcataaattt
ggcgagggcaaggtttactatttgggaacggttcccgaggaggcattctatttggacttc
tttcgggatgtagcagataattcgggcctgcactttatccctgacttgccagaaggtatt
cagatttcgacacgtgtgaaagggtctacgagatatttgttcctaatgaatcttacgcgt
aagcaacagaccatgctgcttgatggtacgtttcgaagtcttctcggcagtagagagatc
ggcccagcactaacgatggctccttatgcggtcgaaatcgtagaacttccccagaaaaat
gtatag

DBGET integrated database retrieval system