KEGG   Paenibacillus ihbetae: BBD41_15685Help
Entry
BBD41_15685       CDS       T05154                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00500  Starch and sucrose metabolism
pib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pib00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBD41_15685
Enzymes [BR:pib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BBD41_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ANY73902
UniProt: A0A1B2E1V7
LinkDB All DBs
Position
complement(3560596..3562074)
Genome map
AA seq 492 aa AA seqDB search
MQRNHTMMQFFEWHVAPDGSHWKRLKEAAPELSKAGVDTVWIPPVTKALSAEDNGYGAYD
LYDLGEFDQKGTVRTKYGTKQELIDAIAACHKHGIAVYVDLVMNHKAGADETERFHVVQV
DEMDRTKEISKPFEIEGWTKFTFPGRGGKYSSFQWNFHHFNGTDYDASRKRAGIYRILGE
NKSWNEKVDHEFGNYDYLMFANIDYSHPEVRKEMIKWGQWLVDTLQCSGFRLDAIKHINH
DFIKEFATAMKKKRGDDFYIVGEFWNPELQACRSYLDRVDYKIDLFDVSLHYKLHAAAKA
GRSFDLRTIFDDTLVQSHPMNAVTFVDNHDSQPHESLESWVEDWFKQSAYALILLRKDGY
PVVFYGDYYGIGGEHSLPGKKEAIDPLLYARAHLAYGEQDDYFDHPNTIGWVRRGLPEVK
NSGCAVVMANGDPGEKRMYVGTHRAGEEWMDLTGNRDERVTIGTDGFGVFPVHGGSVSVW
ARNGDRQNSLGS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaatcataccatgatgcaatttttcgaatggcatgtcgcccccgacggctcg
cattggaaacgtctgaaggaagcggcgcccgagctcagcaaggcgggagtcgatacggta
tggattccaccggtgaccaaagcgctgtcggcggaagataacggctacggtgcgtatgat
ctgtacgatctgggggagtttgatcaaaagggcaccgtacgtacgaaatacggcacgaag
caggaattgatcgatgccatcgcggcctgccacaagcacgggatcgccgtctatgtggat
ctcgtgatgaaccataaggccggagcggacgaaaccgagcgattccatgtggtccaggtc
gatgaaatggaccggaccaaggaaatatcgaagcccttcgagattgagggttggaccaaa
tttacgttccccggccggggcggcaagtactcctctttccagtggaattttcatcatttc
aacgggaccgactacgatgcgagtagaaagcgtgccggcatataccgcattcttggcgag
aacaaatcatggaacgagaaggtggaccatgaattcggcaactatgactatctgatgttc
gccaatatcgattacagccatcccgaggttcgcaaagagatgatcaaatggggccagtgg
ctcgtcgataccctgcaatgcagcggcttccggctggatgcgatcaagcatatcaaccat
gatttcatcaaggagtttgcaacggccatgaagaagaaacggggagacgacttctacatc
gtcggggagttttggaacccggagcttcaggcatgccggagctacctcgaccgggtagat
tacaagatcgatctgtttgacgtatcgcttcactataagcttcatgctgcggccaaagcc
gggcggtccttcgacctgcggacgatcttcgacgatacgctggtgcaatcccatcctatg
aatgccgttacgttcgtcgacaatcatgactcccagccccacgaatcactggaatcctgg
gtggaggactggttcaagcagagcgcttatgccttgatcctgcttcggaaggacggctat
cccgtcgtcttctacggggattattacggcatcggcggggagcattcacttccgggcaag
aaggaagccatcgacccgctcctgtatgcccgggctcacctcgcgtacggagagcaggat
gattatttcgaccatcccaacacgatcggctgggttcgaagagggctgccggaagttaaa
aactccggatgtgcggtcgttatggcaaacggggatcccggcgaaaaacgcatgtatgtc
ggaacccaccgcgccggcgaagagtggatggatctgacaggcaaccgggatgagcgtgtt
acgatcgggaccgacggctttggcgtctttcctgtacacggcggcagcgtatcggtatgg
gcacggaatggggaccgccaaaattcgctgggctcctaa

DBGET integrated database retrieval system