KEGG   Paenibacillus ihbetae: BBD41_21035Help
Entry
BBD41_21035       CDS       T05154                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00020  Citrate cycle (TCA cycle)
pib00480  Glutathione metabolism
pib01100  Metabolic pathways
pib01110  Biosynthesis of secondary metabolites
pib01120  Microbial metabolism in diverse environments
pib01130  Biosynthesis of antibiotics
pib01200  Carbon metabolism
pib01210  2-Oxocarboxylic acid metabolism
pib01230  Biosynthesis of amino acids
Module
pib_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pib_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pib00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD41_21035
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BBD41_21035
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BBD41_21035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANY74847
UniProt: A0A1B2E4M1
LinkDB All DBs
Position
4724717..4726009
Genome map
AA seq 430 aa AA seqDB search
MKLEKFALPTEGEKITIDNGKLQVPNHPIIPFIEGDGTGRDIWKASKRVLDAAVEKAYNG
SKKLAWYEVFAGEKAYNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQE
LDLYTCLRPVRYFNGVPSPVKRPDLVDMVIFRENTEDIYAGIEYKEGSEEVKKVIKFLQE
EMGVHKIRFPETSGIGIKPVSSEGSKRLVRAAVEYAIKHGRKSVTLVHKGNIMKFTEGAF
KNWGYEVAEAEFGDKVFTWAQYDIIKEKDGVDAANAAQKAAEEAGKIIIKDAIADIALQQ
VLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKYA
DKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGMETAINNKTVTYDFARLMEGATEVKCS
EFADEIIKNL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaaaaattcgcactaccaaccgaaggcgaaaaaatcaccatcgacaacggc
aagctgcaggttccaaaccatccgatcatcccttttattgaaggtgacggaacaggacgc
gacatctggaaagcttccaagcgcgtgcttgacgccgctgtagaaaaggcatacaacgga
tccaagaagcttgcctggtatgaagtgttcgcaggtgagaaagcttataatacatacgga
gaatggcttcctaacgatacgctcgaagcaatccgtgaatacatcgttgccatcaaggga
cctttgacgacgccaatcggcggcggcatccgttccctgaacgttgctctgcgccaagag
ctggatctgtacacttgcttgcgcccggttcgctacttcaacggcgtcccgtccccggtt
aaacgtccggacctcgtggacatggttattttccgtgagaacaccgaggacatttatgcc
ggcattgagtacaaggaaggctccgaggaagtgaagaaggttatcaagttcctccaagag
gaaatgggcgttcacaagatccgcttcccggaaacatccggcatcggcatcaagcctgta
tcctccgaaggctccaagcgtcttgtgcgcgcagctgtggaatacgcgatcaagcatggc
cgcaaatccgtaacgctggtgcataaaggcaacatcatgaagttcaccgaaggcgccttc
aaaaactggggctacgaagtggctgaagccgagttcggcgataaagtgttcacttgggca
caatatgacatcatcaaggaaaaagacggcgtagatgcagcgaacgcagcacagaaggcc
gctgaggaagccggcaaaatcatcatcaaggatgcgattgccgacatcgcgctccagcaa
gtgcttacgcgtccaaccgatttcgatgtcatcgcaacgctgaacctgaacggcgactac
ttgtccgacgcgcttgcagcgcaagtaggcggcatcggtatcgctccgggagcgaacatc
aactacgtgacaggtcacgcgatcttcgaagcgactcacggcacggctccgaaatatgcg
gacaaggacgttgtaaaccctggttccgttattctgtccggcgttatgctgcttgagcat
ctcggatggcaggaagctgcggatctgatttacaaaggcatggaaaccgcgatcaacaac
aaaaccgtaacctatgactttgcacgtctgatggaaggcgcaacggaagtgaaatgctcc
gagtttgcggacgaaatcattaaaaacctgtaa

DBGET integrated database retrieval system