KEGG   Paenibacillus ihbetae: BBD41_25700Help
Entry
BBD41_25700       CDS       T05154                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pib  Paenibacillus ihbetae
Pathway
pib00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pib00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBD41_25700
Enzymes [BR:pib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBD41_25700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase
Motif
Other DBs
NCBI-ProteinID: ANY75700
UniProt: A0A1B2E6U3
LinkDB All DBs
Position
5762845..5764608
Genome map
AA seq 587 aa AA seqDB search
MTQLKAVNKQFVLGEEAIQILSGAIHYFRVVPEHWEDRLLKLKACGLNTVETYIPWNWHE
PDEGRFNFSGMADIEAFVTLAGKLGLQVIVRPSPYICAEWEFGGLPGWLLQDPHMQLRCL
DPKFLKKVDAYYDELIPRLVPLLSSNGGPIIAVQIENEYGSYGNDTAYLQYLQEALISRG
VDVLLFTSDGPTDGMLQGGTVPGVTATVNFGSRPAEAFAKLREYRSEDPLMCMEYWNGWF
DHWMKPHHTRDSEDAAAVFAEMLALGASVNFYMFHGGTNFGFYNGANYHDRYEPTITSYD
YDAPLSECGDVTPKYEAVRQVIAKHQGVELGDLPALPEPVRKKAYGTVSMTFYADLLENL
PVLASSEKHRTPVPMELLGHNYGFIVYSTKISGPRQGESLHLQEVHDRAQVFLDGVYQGT
VERWNNAPIPLDIPAAGAKLDIVVENMGRVNYGPRLKDYKGITEGVRMNNQFLYDWSISC
LPMDHLGAVPFGPLSAPNAGRKDRPAFYKGEFHVEDRMDTFVRLDGWVKGVVWINGFNLG
RYWEQGPQATLYLPGPLLKKGSNEIIVFELHHTDKASIELVDKPDLG
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattgaaagcggttaacaagcagtttgttcttggtgaggaagcgattcaaatc
ttatcgggtgccattcattatttccgcgttgtgcctgaacattgggaggatcggctgctg
aagctgaaagcatgcggcttgaatacggtcgagacttacataccttggaattggcatgag
ccggatgaaggaaggttcaatttctccgggatggcggatatcgaagccttcgtcacgctc
gcggggaagctggggctgcaggtcatcgtcagaccgagtccttacatttgcgcagagtgg
gaatttggcggactgccggggtggctgctgcaggatccgcatatgcagcttcgctgcctg
gatccgaagttcctgaaaaaggtcgatgcatattatgacgagttgattccgcgtctggtg
ccgctgttgtcctcgaacggcgggccgatcatcgcggtccaaatcgagaatgaatacggc
agctatggcaatgatacggcatacctgcagtatcttcaggaggcattgatcagcaggggc
gtggatgtgctgctgtttacttcggacggtccgacagacggcatgctgcagggcggcacg
gttcccggtgtaacggccaccgtcaatttcggatccaggccggccgaagcgttcgccaag
ctgcgggagtatcggtccgaagatccgctcatgtgcatggaatattggaacggctggttc
gatcattggatgaagccgcaccatacgcgcgattcggaggacgcagcggcggtatttgcc
gaaatgctggcccttggagcatccgttaacttttatatgttccatggcgggacgaatttc
ggattttacaatggcgcgaattatcatgacagatacgagccgaccatcacgagctacgat
tatgatgcgcctctatcggagtgcggcgatgttacaccgaagtatgaggcggtccggcag
gtgattgcgaagcaccaaggtgtggagctcggggatttgccggcgctgcctgagccggtg
cggaagaaggcatacgggacggtcagcatgactttctatgccgatctgctcgagaatttg
ccggtattggcctccagcgagaagcaccgaacaccggtgccgatggagctgcttggtcat
aactacggttttatcgtatactccacaaaaatttccggtccgcggcaaggcgaatccctg
catctgcaagaagtgcatgaccgagcccaggtgtttctcgatggcgtataccaggggacc
gtggaacgctggaataatgcgcctattcctttggacattccagcagcaggcgccaagctg
gacatcgttgtggagaacatggggcgcgtcaattatggtccccgcttgaaggattacaaa
gggattaccgaaggcgtgcggatgaataaccagtttctgtacgattggagcatttcctgc
ttgccgatggatcatctgggggcagtgccgttcgggccgttgtcggcgcctaatgcaggg
cggaaggaccgtccggcattttataagggagaattccatgtggaagatcggatggacacg
ttcgttcgactggacggctgggtgaagggcgtcgtctggatcaacgggttcaatcttggg
cgatactgggagcagggacctcaagcgacgctttatctgcccggtccgctgctgaagaag
ggaagcaatgaaatcatcgtattcgagctgcatcacacggataaggcaagcatcgaactg
gtcgacaagccggatttgggctaa

DBGET integrated database retrieval system