KEGG   Paenibacillus ihbetae: BBD41_27435Help
Entry
BBD41_27435       CDS       T05154                                 

Definition
(GenBank) catalase HPII
  KO
K03781  
catalase [EC:1.11.1.6]
Organism
pib  Paenibacillus ihbetae
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pib00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BBD41_27435
  Amino acid metabolism
   00380 Tryptophan metabolism
    BBD41_27435
Enzymes [BR:pib01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     BBD41_27435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6180144..6182201
Genome map
AA seq 685 aa AA seqDB search
MKDSNSNNSSKKTIKDQQLDQFTVDNDGKDLTTNQGLRVSEDEHSLKAGVRGPTLMEDFH
FREKMTHFDHERIPERIVHARGFGAHGFFQVYESMKAFTRAKFLQDPSTVTPVFVRFSTV
AGSRGSADTVRDVRGFATKFYTEEGNYDLVGNNMPVFFIQDAMKFPDFVHAVKPEPHNEI
PQAQSAHDTFWDFVANNTESVHMVMWAMSDRALPRSYRMMEGFGVHTFRFVNEQGRAHFV
KFHWKPVLGTHSLVWDETQKLAGKDPDFNRRDLWEAIESGNYPEYELGVQMIPEEDEFRF
DFDILDPTKIWPEELVPVRLIGKMTLNRNTNNFFAETEQIAFHPGHVVPGIDFTNDPLLQ
GRLFSYTDTQLSRLGGPNFHEIPINRPIAPVHNNQRDGMHRMTINKGPVSYHKNGIAGNT
PAPVPGEYGGYEHYTEKVEGRKVRERSDSFKDHFSQASMFWNSMSEVEKQHIVSAFQFEL
GKVQRKEIRQQVVDVFANVDGELATRISEGIGTIPPQKSGSASSLVSPALSMMNTVKLPL
TRKVAVLAGNGYSDELPFVLTQLQQAGVITEIVSAKLGIIRGKTSGELEVKHSLLGADSV
LFDAVLVAGGTLSVSELLSEPKVLDFVREAYQHYKPIAAIDEGVNLLPSASGDGIVTARE
GDDLKSFGQSFIGAIAAHRHWLRTV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaggattccaattcgaacaacagcagcaagaagacgatcaaggaccagcagctggat
cagttcacggtggataatgacggcaaggacttgactaccaaccagggacttcgggtatcc
gaggatgagcattcgctgaaagcgggcgtacgaggaccgaccctcatggaggatttccac
ttcagggagaaaatgacccattttgaccatgaacggattcctgaacgcatcgtccacgcg
cgaggcttcggagctcatggtttttttcaggtgtacgaatccatgaaggcttttaccaga
gcgaagttcttgcaggatccgtcaacggttacgccggtgttcgtccgtttctcaacggtt
gcaggctccagaggctctgcggatacggtcagggatgtgaggggctttgcgaccaagttt
tatacggaggagggcaattacgaccttgtcggcaacaatatgccggtgttcttcattcag
gatgcaatgaagtttcctgatttcgtccatgccgtgaagccggagccgcacaacgaaatt
ccgcaggcccagtccgcgcatgatacattttgggatttcgtggccaataataccgagagc
gtgcatatggtgatgtgggcaatgtccgaccgtgcgctgccgagaagctaccggatgatg
gagggcttcggtgtacatacgttccggtttgtgaatgagcaaggcagagcccattttgtg
aaattccactggaagccggtgcttggcacccattccttagtttgggatgagacgcagaag
cttgcgggaaaggatccggatttcaaccgccgcgatctgtgggaagcgattgaatcgggg
aattatccggagtatgagcttggtgtgcagatgattccggaggaagatgaattccgcttt
gacttcgacattctggatcctacgaaaatatggccggaggagctcgtcccggtgcggctt
atcggaaaaatgacgctgaaccgcaataccaataatttcttcgccgagaccgagcaaatc
gccttccatcccggacatgtcgtgccggggattgatttcaccaacgacccgctgctgcaa
ggccggctgttctcctatacggatacgcagctgtcccgtctcggcggaccgaactttcac
gagattccgatcaatcgtccgattgcgccggtccacaataaccagcgggacggcatgcat
cgcatgacgatcaacaaaggtccggtcagctatcacaagaacggaatcgcagggaatacg
ccggcaccggtgccgggtgagtacggaggttatgaacattataccgaaaaggtagagggc
cgaaaggtgagagagcgaagcgacagcttcaaggatcatttcagccaggcgtccatgttc
tggaacagcatgtccgaagtcgagaagcagcatatcgtctccgcgttccagttcgagctg
ggcaaggtgcagcggaaggaaattcgccagcaggttgtcgacgtgttcgcgaacgtggac
ggtgagctcgccacccgcatatcggaaggcatcggcacgattccgccgcaaaaaagcggt
tccgcatccagcttggtctcaccagccctgagcatgatgaataccgtgaagctaccgctt
acccgtaaagttgccgtgttggccggcaacggatattcggacgagctgccgttcgtcctt
acccaactgcagcaggccggtgtcataacggagatcgtaagcgccaagcttggcataatt
cgcggcaagaccagcggcgagcttgaagtgaagcattccctgctcggagccgattcggtc
ttatttgacgcggtgctcgtagcgggagggacactcagtgtatccgagcttctgagcgag
ccaaaggtacttgacttcgtaagagaggcctatcagcattacaagccgattgcagcgatc
gacgagggcgtcaatttactgccttcggccagcggcgacggtatcgttacagcccgcgag
ggcgacgatttgaaatccttcgggcaaagtttcatcggagccattgcagctcaccggcat
tggttaagaaccgtgtaa

DBGET integrated database retrieval system