KEGG   Pediococcus inopinatus: PI20285_07315Help
Entry
PI20285_07315     CDS       T05337                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pio  Pediococcus inopinatus
Pathway
pio00010  Glycolysis / Gluconeogenesis
pio00260  Glycine, serine and threonine metabolism
pio00680  Methane metabolism
pio01100  Metabolic pathways
pio01110  Biosynthesis of secondary metabolites
pio01120  Microbial metabolism in diverse environments
pio01130  Biosynthesis of antibiotics
pio01200  Carbon metabolism
pio01230  Biosynthesis of amino acids
Module
pio_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pio_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pio00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PI20285_07315
  Energy metabolism
   00680 Methane metabolism
    PI20285_07315
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PI20285_07315
Enzymes [BR:pio01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PI20285_07315
Membrane trafficking [BR:pio04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PI20285_07315
Exosome [BR:pio04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PI20285_07315
  Exosomal proteins of melanoma cells
   PI20285_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AVL00460
UniProt: A0A0R2I994
LinkDB All DBs
Position
complement(1441648..1442319)
Genome map
AA seq 223 aa AA seqDB search
MTYLVLLRHGQSEANRDNVYTGWSDVPLTQQGRAEAKRAGQLIEQTQIQFTDVHTSLLKR
AITTADIVMDQIHQNWLPIHKAWRLNERHYGALRGQNKDKTREIYGVRQVALWRRSFKAV
PPLLEATESDRRYVELGDIEPRGESLEMAYKRLLPYWIDEIAPRLLNGQNQLVVAHGSTL
RALIKYLEEISDEGIDGVEVANGEPIVYQFDDQLKIISKKFLD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacttacttagtcttattgcggcatggtcaaagtgaagcaaatcgtgataatgtttac
actggttggagcgatgtcccgctaactcagcagggaagagctgaagctaaaagggcaggc
caactgattgaacaaacacagattcagtttacagatgtgcatacttcacttttaaagcgc
gcaattacaacggcagacattgtcatggatcagattcatcagaactggttaccgattcac
aaggcctggcgcttaaatgaacgtcactatggcgctttacgtggccaaaataaggataaa
acgcgagaaatttacggtgttcgtcaagttgctttgtggcgccggagctttaaggctgtt
ccgccgttgctagaagcgactgaatcagatcggcgatacgttgagcttggagacatcgaa
ccacgcggtgagagccttgagatggcttataagcgattattaccgtattggatagatgaa
attgcaccacgtttgctaaatggacagaatcaattggttgtagcacacgggagtactttg
cgtgcgttgatcaaatacttggaagaaattagtgacgaaggtattgatggggttgaagtg
gcaaacggggaaccaattgtttaccagtttgatgaccagttgaaaattattagtaagaag
ttcttagattaa

DBGET integrated database retrieval system