KEGG   Pirellula sp. SH-Sr6A: VN12_21630Help
Entry
VN12_21630        CDS       T04360                                 

Gene name
nedA_2
Definition
(GenBank) Sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pir  Pirellula sp. SH-Sr6A
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pir00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    VN12_21630 (nedA_2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    VN12_21630 (nedA_2)
Enzymes [BR:pir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     VN12_21630 (nedA_2)
Bacterial toxins [BR:pir02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   VN12_21630 (nedA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5291280..5292455
Genome map
AA seq 391 aa AA seqDB search
MTRLISPLIALWTIACLVSQGFGAEPLLETVKVFPAGMEGVTLYRIPGMVVTPNGTVLAY
VEARRNTKADWGEIEIHLRRSVDGGRTWLPSQNIAHRGKRIEGNPRKASGGEREQTVNNP
VMIVDRETGAVEMLYCINYARCFSMRSLDDGATWSEPVEITATFEPFRNSYPWTVIATGP
GHGVQLSSGRLVVPIWLAYGKDGAHAPSAAATIYSDDHGKSWQAGNMVFPNQGAFGNPNE
TTIAVRHAGDCLLVNRNVSKPNRKLVSRSPDGASRWSTPRFQPELWEPICMASVATYMHK
PGVILYSAPRTLARDASGEEIGAGRGKRERLTIQWSEDDGESWPHSKLLVAGPSAYSDLA
VLADGTILCLYEGDGDVELKRLNWEWLMTER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcctcatttcccctctgattgcgttgtggaccatcgcctgtctcgtgtcccaa
ggctttggcgccgagccgttgttggagaccgtgaaggtctttccggctggcatggagggc
gtgaccctctatcgcattccaggcatggtcgttactccgaacgggacggtgttggcgtat
gtagaagcgcggcgcaatacaaaagcggactggggagagatcgaaatccatttgcgccgt
tcggtcgatggcggtaggacttggttgccatcgcaaaacattgcgcatcgcgggaaacgg
atcgaggggaatccgaggaaagcctctgggggagagcgagagcaaacggtgaacaacccc
gtgatgatcgtcgatcgagagaccggggcagtcgaaatgctgtattgcatcaactatgcg
agatgtttttcgatgcgcagtctggatgacggagcgacctggagtgagccggtcgagatt
acagccacattcgagccgtttcgaaactcgtatccttggaccgtgatcgccaccggccca
ggtcatggggtccagctctcctcaggtcgacttgtcgttcccatttggcttgcctatgga
aaggacggagcgcacgcgccgtccgcggccgcgaccatttacagcgatgatcacgggaaa
agttggcaagctgggaacatggtctttcccaaccaaggagcgtttgggaatccgaatgaa
acaacgatcgcggtacgccatgctggcgattgcttgctggtgaatcggaacgtttccaaa
ccgaaccgcaaactggtgtccaggagcccggatggcgcgagccgttggagcacgcctcgg
tttcagccagaactttgggagccaatctgcatggcgagcgtcgcgacctacatgcacaag
cccggggtgatactctattcggctccccgaacgctcgcacgcgatgcttcgggagaagag
atcggcgcgggaagagggaagcgagaaaggctgacgatccagtggagcgaagacgacgga
gagtcgtggccccattccaagctgcttgttgcaggcccctccgcatactccgatctcgcc
gtgctcgccgacggaaccatcctttgcctctacgaaggtgacggagacgtagagctcaaa
cggctgaactgggagtggttgatgaccgagcgctag

DBGET integrated database retrieval system