KEGG   Pontibacter korlensis: PKOR_07590Help
Entry
PKOR_07590        CDS       T03841                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pko  Pontibacter korlensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PKOR_07590
  Amino acid metabolism
   00310 Lysine degradation
    PKOR_07590
   00380 Tryptophan metabolism
    PKOR_07590
Enzymes [BR:pko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PKOR_07590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1779939..1782698
Genome map
AA seq 919 aa AA seqDB search
MDKYTYIANAHGDYIDGLYKAYQQDPESVDAGWRKFFEGFEFATAYSENGHEAAEGVAAA
PAKGTAAAAGESEKEVAVRNLIHAYRTRGHLRSKTNPVRARKDRRARLDLADFGLTEADL
DTIFQVGEIIGIGPATLRDIEAALKKIYEGSIGFEYMYIRDPEVLEWFKQKVERESLSFN
PSIEYKKRILSKLNEAVVFENFLHTKFLGQKRFSLEGGETTIPALDAIIDKGSELGVEEV
VIGMAHRGRLNVLANIMGKTYEQIFSEFEGTAVPDLTMGDGDVKYHMGYSSEVVTPSGKK
VNLKLAPNPSHLEAVNPVVEGFVRAKIDCMYDKDPDKVLPILIHGDAAIAGQGIVYEVTQ
MANLEGYNTGGTIHFVINNQVGFTTDFEDARSSIYSTDIAKIIDAPVLHVNGDDPEAVVF
AMRMAMEYRQKVNNDIFIDMVCYRRHGHNESDEPKFTQPQLYNLISKHANPREVYNKTLI
SRGEVDAELAKNMDKEFRSLLQDRLDMVKQKPLPYNYQVLEKEWQELRRSKPEDFNQSPE
TGVSAEVVEAVGKALTTLPQGFKPLKQIEKLIKERKEMFFETKQLNWAAGELLAYGSVLL
DGRVVRFSGQDVQRGTFSHRHAVLHDAVTSAAYNNLNHMREGQGSFEIYNSLLSEYGVLG
FEFGYAMANPNALVIWEAQFGDFANGAQVMIDQFISATESKWQRMNGLVMLLPHGYEGQG
PEHSNARPERFLQLSAENNMFVTYITTPANLFHFMRRQLALPFRKPAVNMSPKSLLRHPA
VVSPVEDFTSGGFKEVIGDTYASAKSVKKVLLCWGKVYFDLLEEQQKNKRKDVAIIRMEQ
LAPFPKVQLEAELSKYKNAKIYWVQEEPENMGAWNYILRIMRNGVEDVVARKASASPATG
YLKVHAKEQQELIDRAFAI
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggataaatatacctatatcgccaacgcgcacggcgattacatcgatgggctgtataag
gcctatcaacaagaccctgagtcagtggacgctgggtggcgcaagttttttgaggggttt
gagtttgcaacagcgtacagcgaaaatggccatgaggctgccgaaggcgttgctgccgct
cctgccaaaggtactgcagctgccgctggcgaatctgaaaaagaggttgcagtgcgcaac
ctgatccacgcttaccgtacgcgcggccacctacgctctaaaactaacccggtgcgtgcc
cgcaaagaccgcagagctagacttgatttggctgactttggtcttacagaggctgacttg
gatactattttccaggtaggtgagattattggcatcgggccagctacgctgcgcgatatc
gaagccgcactgaagaagatctacgagggctctattggttttgaatacatgtacatccgt
gatccggaagtgctggagtggttcaagcagaaggtagagcgtgagtctcttagcttcaac
ccatctatagagtataaaaaacgcatcctgtctaagctgaacgaggctgtggtgttcgag
aacttcctgcacacgaagtttttgggccagaagcgcttctcattggaaggtggcgaaaca
actattcctgccctggatgctattattgataaaggctcagaactaggtgttgaggaagta
gtaataggtatggctcaccgtggccgcctgaacgtgctggcaaacatcatgggcaagacc
tatgagcagatcttctctgagtttgaaggtactgccgttccggacctgacaatgggtgac
ggtgacgtgaaataccacatgggttattcttctgaggtggtaacaccatcaggtaagaaa
gtaaacctgaagctggctccgaacccatcacaccttgaggcggtaaatccggtagtggaa
ggctttgtgcgtgccaagatagactgcatgtatgataaggatccagacaaggtgcttcct
atattgatacatggtgatgcagctattgctggacaaggcattgtgtatgaagttacacaa
atggcaaacctggaaggctacaacacaggtggtaccatccactttgtgatcaacaaccag
gtaggtttcactactgactttgaagacgctcgttcttctatctacagcactgatattgcc
aaaattattgatgcgcctgtactgcatgtaaatggagatgatccggaagcagtggtattt
gcgatgcgtatggcaatggagtaccgtcagaaggtgaacaacgatatctttattgacatg
gtttgctatcgtcgccatggccataacgagtcagatgagcctaagtttacgcagccgcaa
ctatataacctgatatcaaagcacgctaacccgcgtgaggtatacaacaaaacgcttatc
tctcgcggagaggttgacgcagagttggcgaagaacatggacaaggagttccgcagcttg
ttgcaggaccgcctggacatggtgaagcaaaagccattgccatataactaccaggtgctg
gagaaagagtggcaggaactacgccgctccaagccggaggacttcaaccagtctcctgag
accggtgtgtcagccgaggttgttgaggcagtaggaaaagcgcttactacacttccacaa
ggctttaagccactcaagcagatcgagaagcttatcaaagagcgtaaggagatgttcttt
gagaccaagcagctgaactgggcagccggtgaattgctggcttacggttctgtgttattg
gatggcagggtagtgcgtttctctggccaggatgtgcagcgtggtacgttctcgcaccgc
catgcagtgttgcatgatgctgttacaagcgcggcttacaataaccttaaccacatgcgt
gaggggcagggctctttcgagatctataactcgttgctgtcggagtatggtgtgcttggt
tttgagttcggttatgccatggctaacccgaatgctcttgttatctgggaagctcagttt
ggtgactttgccaacggtgcccaagtaatgatcgaccagtttatctctgctactgaatcg
aagtggcagcgtatgaacggtctggtgatgctgttgccgcacggctacgaaggtcaggga
ccagagcactcaaatgcacgccctgagcgcttcctgcagttgtcagccgagaacaacatg
tttgtgacgtacatcactacgccagctaacctgttccactttatgcgtcgtcagttggcc
ctgccattccgcaagccagctgttaacatgtcgcctaagtcgctgcttcgtcatcctgcc
gtggtttctccagtagaggatttcacatcaggaggctttaaggaagtaattggcgatact
tatgcgtcggctaagtcggtgaagaaagtgttgctgtgctggggtaaagtatatttcgac
ctgttggaagagcagcagaagaacaagcgtaaggatgtggccattatccgtatggagcag
ttggcgccattcccgaaagttcagctggaggcagagcttagcaagtataagaatgccaaa
atttactgggtacaggaagagcctgaaaacatgggcgcctggaactacatcctgcgtatc
atgcgcaacggtgtagaagacgtagtagcccgtaaggctagtgcttcaccagcaaccggc
tacctgaaagtacatgctaaagagcagcaagaactgatcgacagagcgtttgctatatag

DBGET integrated database retrieval system