KEGG   Pseudomonas koreensis: AYO71_00510Help
Entry
AYO71_00510       CDS       T04647                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pkr  Pseudomonas koreensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYO71_00510
Enzymes [BR:pkr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AYO71_00510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(121558..122457)
Genome map
AA seq 299 aa AA seqDB search
MNTPNVEAVKQDELNCWRIRHGKAEVLVAQQGAHILSYQIDGQPPIIWLNDKAEFKTGKS
IRAGVPVCWPWFGKFERNPSSVQAMYTGEQPAPAHGLVRAMDWELGNIESEADGIKVEFK
LPYPEGGLPGWPHEVDLTLTLHLADQLHYSLTSHNRGTDSVTLSQALHTYFAVSDVRNVH
VDGVAGLNYIETLDDWNTASQSDDLHFTGETDRIYLDVPPQLSIVDPTWERRIVLTSTGS
RTAVIWNPWIDRAAALPDMDNDGWQRMLCIETANVMDDLVTLAPGARHTMGVSVASKPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccaacgttgaagccgtgaaacaggatgaactgaactgctggcgcatccgc
cacggcaaggccgaagtgctggtggcccagcaaggcgcgcacatcctcagttatcagatc
gacggccagccgccgatcatctggctcaacgacaaggccgagttcaagaccggcaagagc
atccgcgccggcgtgccggtgtgctggccgtggttcggcaaattcgaacgcaacccgagc
agcgtgcaggccatgtataccggcgagcagccggcccccgcgcacggtctggtgcgggcg
atggactgggagttgggcaacatcgaatcagaggctgacggcatcaaggtcgaattcaag
ctgccctacccggaaggtggcctgccgggctggccccacgaagtcgatctgaccctgacc
ctgcatctggcggatcaactgcattacagcctgaccagccataaccgggggactgacagc
gtcacgctgagtcaggcgctgcacacctatttcgccgtgagtgacgtgcgtaatgtgcat
gtcgacggcgtggccgggctgaattacatcgagaccctggacgactggaacacggccagc
cagagcgacgatctgcatttcaccggcgagaccgaccgcatctacctcgacgttccgccg
caattgagcatcgttgatccgacctgggaacgacgcatcgtgctgacctctaccggctcg
cgcactgcggtgatctggaacccgtggatcgaccgcgccgccgcactgccggacatggac
aacgatggctggcagcgcatgctgtgcatcgaaacggcgaatgtgatggatgatctagtc
acactggcgccgggtgcgcgccatacgatgggtgttagcgtcgccagcaaaccgctttaa

DBGET integrated database retrieval system